• Gene id: 2865

Gene Summary

• Gene Symbol: FFAR3   Gene   UCSC   Ensembl
• Aliases: FFA3R, GPR41, GPR42
• Gene name: free fatty acid receptor 3
• Alternate names: free fatty acid receptor 3, G-protein coupled receptor 41,
• Gene location: 19q13.12 (35358105: 35360490)     Exons: 2     NC_000019.10

Protein Summary

• Protein general information: O14843  
  • Name: Free fatty acid receptor 3 (G protein coupled receptor 41)
  • Length: 346  
  • Mass: 38649
  • Tissue specificity: Highest level in adipose tissue, and lower expression across all tissues tested. Expressed in sympathetic ganglia. {ECO
• Sequence:

  MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEA
  ANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVV
  YVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAG
  LLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ
  WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR013312  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000328230
• Other Databases: GeneCards:  FFAR3  Malacards:  FFAR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0014061	regulation of norepinephrine secretion	ISS	biological process
GO:0046626	regulation of insulin receptor signaling pathway	ISS	biological process
GO:0090276	regulation of peptide hormone secretion	ISS	biological process
GO:0046885	regulation of hormone biosynthetic process	ISS	biological process
GO:0045776	negative regulation of blood pressure	ISS	biological process
GO:0032722	positive regulation of chemokine production	ISS	biological process
GO:0002879	positive regulation of acute inflammatory response to non-antigenic stimulus	ISS	biological process
GO:0002720	positive regulation of cytokine production involved in immune response	ISS	biological process
GO:0002385	mucosal immune response	ISS	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0071398	cellular response to fatty acid	IDA	biological process
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0014061	regulation of norepinephrine secretion	ISS	biological process
GO:0046626	regulation of insulin receptor signaling pathway	ISS	biological process
GO:0090276	regulation of peptide hormone secretion	ISS	biological process
GO:0046885	regulation of hormone biosynthetic process	ISS	biological process
GO:0045776	negative regulation of blood pressure	ISS	biological process
GO:0032722	positive regulation of chemokine production	ISS	biological process
GO:0002879	positive regulation of acute inflammatory response to non-antigenic stimulus	ISS	biological process
GO:0002720	positive regulation of cytokine production involved in immune response	ISS	biological process
GO:0002385	mucosal immune response	ISS	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881