• Gene id: 286436

Gene Summary

• Gene Symbol: H2BW2   Gene   UCSC   Ensembl
• Aliases: H2BFM, H2BM
• Gene name: H2B.W histone 2
• Alternate names: histone H2B type F-M, H2B histone family member M, H2B.M histone, H2B/s, histone H2B.s,
• Gene location: Xq22.2 (104039752: 104042453)     Exons: 4     NC_000023.11
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA
• OMIM: 609712

Protein Summary

• Protein general information: P0C1H6  
  • Name: Histone H2B type F M (Histone H2B.s) (H2B/s)
  • Length: 154  
  • Mass: 17001
• Sequence:

  MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPRVLKQVHQGL
  SLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGTNAALRTSLCAIW
  QQRK

• Structural information:
  • Interpro: IPR009072  IPR007125  IPR000558  
  • STRING: ENSP00000347119
• Other Databases: GeneCards:  H2BW2  Malacards:  H2BW2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006334	nucleosome assembly	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0000786	nucleosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0000786	nucleosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa05322	Systemic lupus erythematosus

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray