About Us

Search Result


Gene id 286436
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol H2BW2   Gene   UCSC   Ensembl
Aliases H2BFM, H2BM
Gene name H2B.W histone 2
Alternate names histone H2B type F-M, H2B histone family member M, H2B.M histone, H2B/s, histone H2B.s,
Gene location Xq22.2 (104039752: 104042453)     Exons: 4     NC_000023.11
Gene summary(Entrez) Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA
OMIM 609712

Protein Summary

Protein general information P0C1H6  

Name: Histone H2B type F M (Histone H2B.s) (H2B/s)

Length: 154  Mass: 17001

Sequence MAAASAMAEASSETTSEEGQSIQEPKEANSTKAQKQKRRGCRGSRRRHANRRGDSFGDSFTPYFPRVLKQVHQGL
SLSQEAVSVMDSMIHDILDRIATEAGQLAHYTKRVTITSRDIQMAVRLLLPGKMGKLAEAQGTNAALRTSLCAIW
QQRK
Structural information
Interpro:  IPR009072  IPR007125  IPR000558  
STRING:   ENSP00000347119
Other Databases GeneCards:  H2BW2  Malacards:  H2BW2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0006334 nucleosome assembly
IBA biological process
GO:0003677 DNA binding
IBA molecular function
GO:0000786 nucleosome
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0046982 protein heterodimerizatio
n activity
IEA molecular function
GO:0000786 nucleosome
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05034Alcoholism
hsa05203Viral carcinogenesis
hsa05322Systemic lupus erythematosus
Associated diseases References
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract