• Gene id: 2864

Gene Summary

• Gene Symbol: FFAR1   Gene   UCSC   Ensembl
• Aliases: FFA1R, GPCR40, GPR40
• Gene name: free fatty acid receptor 1
• Alternate names: free fatty acid receptor 1, G-protein coupled receptor 40,
• Gene location: 19q13.12 (35351541: 35352463)     Exons: 1     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for medium and long chain free fatty acids and may be involved in the metabolic regulation of insu

Protein Summary

• Protein general information: O14842  
  • Name: Free fatty acid receptor 1 (G protein coupled receptor 40)
  • Length: 300  
  • Mass: 31457
  • Tissue specificity: Detected in brain and pancreas. Detected in pancreatic beta cells. {ECO
• Sequence:

  MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLPLKAVEALASGAWPLP
  ASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRPCYSWGVCAAIWALVLCHLGLVFGLEAPGGW
  LDHSNTSLGINTPVNGSPVCLEAWDPASAGPARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWV
  AGGALLTLLLCVGPYNASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR013312  IPR013313  
  • Prosite: PS50262
  • PDB: 4PHU 5KW2 5TZR 5TZY
  • PDBsum: 4PHU 5KW2 5TZR 5TZY
  • STRING: ENSP00000246553
• Other Databases: GeneCards:  FFAR1  Malacards:  FFAR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0045125	bioactive lipid receptor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0070542	response to fatty acid	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0032691	negative regulation of interleukin-1 beta production	IMP	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0030073	insulin secretion	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0045125	bioactive lipid receptor activity	IEA	molecular function
GO:0051928	positive regulation of calcium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0070542	response to fatty acid	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04911	Insulin secretion

Diseases

Associated diseases	References
type 2 diabetes mellitus	PMID:19758793
type 2 diabetes mellitus	PMID:19208915
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881