• Gene id: 286256

Gene Summary

• Gene Symbol: LCN12   Gene   UCSC   Ensembl
• Gene name: lipocalin 12
• Alternate names: epididymal-specific lipocalin-12, epididymis secretory sperm binding protein, lipocalcin 12,
• Gene location: 9q34.3 (136949179: 136955504)     Exons: 10     NC_000009.12
• Gene summary(Entrez): Members of the lipocalin family, such as LCN12, have a common structure consisting of an 8-stranded antiparallel beta-barrel that forms a cup-shaped ligand-binding pocket or calyx. Lipocalins generally bind small hydrophobic ligands and transport them to
• OMIM: 615165

Protein Summary

• Protein general information: Q6JVE5  
  • Name: Epididymal specific lipocalin 12
  • Length: 192  
  • Mass: 21500
• Sequence:

  MRLLCGLWLWLSLLKVLQAQTPTPLPLPPPMQSFQGNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGR
  FEVWNAMTRGQHCDTWSYVLIPAAQPGQFTVDHGVEPGADREETRVVDSDYTQFALMLSRRHTSRLAVLRISLLG
  RSWLLPPGTLDQFICLGRAQGLSDDNIVFPDVTGWSPQASVC

• Structural information:
  • Interpro: IPR012674  IPR002345  IPR000566  
  • STRING: ENSP00000360696
• Other Databases: GeneCards:  LCN12  Malacards:  LCN12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015909	long-chain fatty acid transport	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001972	retinoic acid binding	ISS	molecular function
GO:0036094	small molecule binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R