• Gene id: 286133

Gene Summary

• Gene Symbol: SCARA5   Gene   UCSC   Ensembl
• Aliases: NET33, Tesr
• Gene name: scavenger receptor class A member 5
• Alternate names: scavenger receptor class A member 5, scavenger receptor class A, member 5 (putative), scavenger receptor hlg, testis expressed scavenger receptor,
• Gene location: 8p21.1 (27992672: 27869882)     Exons: 9     NC_000008.11

Protein Summary

• Protein general information: Q6ZMJ2  
  • Name: Scavenger receptor class A member 5 (Scavenger receptor hlg)
  • Length: 495  
  • Mass: 53994
• Sequence:

  MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASICCTQLGSLSALKHAVLGLYLLVFLILVG
  IFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLE
  GALWGLQAQAVQTEQAVALLRDRTGQQSDTAQLELYQLQVESNSSQLLLRRHAGLLDGLARRVGILGEELADVGG
  VLRGLNHSLSYDVALHRTRLQDLRVLVSNASEDTRRLRLAHVGMELQLKQELAMLNAVTEDLRLKDWEHSIALRN
  ISLAKGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPGPKGDDGKLGATGPMGMRGFKGDRGPKGEKG
  EKGDRAGDASGVEAPMMIRLVNGSGPHEGRVEVYHDRRWGTVCDDGWDKKDGDVVCRMLGFRGVEEVYRTARFGQ
  GTGRIWMDDVACKGTEETIFRCSFSKWGVTNCGHAEDASVTCNRH

• Structural information:
  • Protein Domains: (305..35-)
    (/note="Collagen-like-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03070-)
    (393..49-)
    (/note="SRCR-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03070"-)
  • Interpro: IPR008160  IPR034726  IPR001190  IPR017448  IPR036772  
  • Prosite: PS00420 PS50287
  • STRING: ENSP00000346990
• Other Databases: GeneCards:  SCARA5  Malacards:  SCARA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070287	ferritin receptor activity	ISS	molecular function
GO:0070207	protein homotrimerization	ISS	biological process
GO:0006879	cellular iron ion homeostasis	ISS	biological process
GO:0034755	iron ion transmembrane transport	ISS	biological process
GO:0006897	endocytosis	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0070287	ferritin receptor activity	IEA	molecular function
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034755	iron ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0034605	cellular response to heat	IEA	biological process
GO:0070207	protein homotrimerization	IEA	biological process
GO:0070287	ferritin receptor activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0034755	iron ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0070287	ferritin receptor activity	IEA	molecular function
GO:0006897	endocytosis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034755	iron ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray