Male Infertility Database

Search Result

Gene id

285955

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

SPDYE1 Gene UCSC Ensembl

Aliases

Ringo1, SPDYB2L2, SPDYE, WBSCR19

Gene name

speedy/RINGO cell cycle regulator family member E1

Alternate names

putative WBSCR19-like protein 6, Speedy E, Williams Beuren syndrome chromosome region 19 protein, speedy homolog E1, speedy protein E1, williams-Beuren syndrome chromosomal region 19 protein,

Gene location

7p13 (43997867: 44011039) Exons: 10 NC_000007.14

Gene summary(Entrez)

This gene is located at chromosome 7p13 which is close to the Williams Beuren syndrome chromosome region 7q11.23. [provided by RefSeq, Jul 2008]

OMIM

617623

Protein Summary

Protein general information

Q8NFV5

Name: Speedy protein E1 (Williams Beuren syndrome chromosomal region 19 protein)

Length: 336 Mass: 40668

Sequence

MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPIL
LEHHKDFNSQLAPGVDPSPPHRSFCWKRKMEWWDKSEESEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLV
LPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRLHFFLALYLANDMEEDDEDSK
QNIFHFLYGKNRSRIPLLRKRRFQLYRSMNPRARKNRSHIPLVRKRRFQLRRCMNPRARKNRSQIVLFQKRRFHF
FCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS

Structural information

Interpro:	IPR020984
STRING:	ENSP00000258704

Other Databases

GeneCards: SPDYE1 Malacards: SPDYE1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0019901	protein kinase binding	IBA	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Expand All | Collapse All

Associated diseases	References
Williams-Beuren syndrome	KEGG:H01439
Williams-Beuren syndrome	KEGG:H01439
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All