• Gene id: 285852

Gene Summary

• Gene Symbol: TREML4   Gene   UCSC   Ensembl
• Aliases: TLT-4, TLT4
• Gene name: triggering receptor expressed on myeloid cells like 4
• Alternate names: trem-like transcript 4 protein, TREM like transcript 4, triggering receptor expressed on myeloid cells-like protein 4,
• Gene location: 6p21.1 (41228286: 41239385)     Exons: 3     NC_000006.12
• OMIM: 614664

Protein Summary

• Protein general information: Q6UXN2  
  • Name: Trem like transcript 4 protein (TLT 4) (Triggering receptor expressed on myeloid cells like protein 4)
  • Length: 200  
  • Mass: 21924
• Sequence:

  MAWGGVHTCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTLLVTSSKPWTA
  VQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIITVLRNISLVVSPAPTTSPMWTLPWLPTSTVL
  ITSPEGTSGHPSINGSETRKSRAPACLGSGGPRFLVLVLCGLLLAKGLML

• Structural information:
  • Protein Domains: (26..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000342570
• Other Databases: GeneCards:  TREML4  Malacards:  TREML4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0045088	regulation of innate immune response	IBA	biological process
GO:0034157	positive regulation of toll-like receptor 7 signaling pathway	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0034157	positive regulation of toll-like receptor 7 signaling pathway	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray