• Gene id: 285704

Gene Summary

• Gene Symbol: RGMB   Gene   UCSC   Ensembl
• Aliases: DRAGON
• Gene name: repulsive guidance molecule BMP co-receptor b
• Alternate names: RGM domain family member B, DRG11-responsive axonal guidance and outgrowth of neurite, RGM domain family, member B, repulsive guidance molecule B, repulsive guidance molecule family member b,
• Gene location: 5q15 (98768631: 98796493)     Exons: 9     NC_000005.10
• Gene summary(Entrez): RGMB is a glycosylphosphatidylinositol (GPI)-anchored member of the repulsive guidance molecule family (see RGMA, MIM 607362) and contributes to the patterning of the developing nervous system (Samad et al., 2005 [PubMed 15671031]).[supplied by OMIM, Apr
• OMIM: 612687

Protein Summary

• Protein general information: Q6NW40  
  • Name: RGM domain family member B (DRG11 responsive axonal guidance and outgrowth of neurite) (DRAGON)
  • Length: 437  
  • Mass: 47547
• Sequence:

  MGLRAAPSSAAAAAAEVEQRRSPGLCPPPLELLLLLLFSLGLLHAGDCQQPAQCRIQKCTTDFVSLTSHLNSAVD
  GFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHAGAREH
  RRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKITIIFKAHHE
  CTDQKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVERESGHYVEMHARYIGTTVFVRQVGRYLTLAIRMPEDLA
  MSYEESQDLQLCVNGCPLSERIDDGQGQVSAILGHSLPRTSLVQAWPGYTLETANTQCHEKMPVKDIYFQSCVFD
  LLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGSDLSVSLGLTCLILIVFL

• Structural information:
  • Interpro: IPR033608  IPR016123  IPR040287  IPR009496  IPR010536  
  • PDB: 4BQ6 4BQ7 4BQ8 4UHZ 4UI0 4UI2
  • PDBsum: 4BQ6 4BQ7 4BQ8 4UHZ 4UI0 4UI2
  • DIP: 61607
  • STRING: ENSP00000308219
• Other Databases: GeneCards:  RGMB  Malacards:  RGMB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	ISS	biological process
GO:0042802	identical protein binding	ISS	molecular function
GO:0007155	cell adhesion	ISS	biological process
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	ISS	cellular component
GO:0046658	anchored component of plasma membrane	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0030509	BMP signaling pathway	ISS	biological process
GO:0030509	BMP signaling pathway	IBA	biological process
GO:0015026	coreceptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R