• Gene id: 285641

Gene Summary

• Gene Symbol: SLC36A3   Gene   UCSC   Ensembl
• Aliases: PAT3, TRAMD2, tramdorin2
• Gene name: solute carrier family 36 member 3
• Alternate names: proton-coupled amino acid transporter 3, proton/amino acid transporter 3, solute carrier family 36 (proton/amino acid symporter), member 3, tramdorin 2,
• Gene location: 5q33.1 (151303765: 151276357)     Exons: 3     NC_000005.10
• OMIM: 608332

Protein Summary

• Protein general information: Q495N2  
  • Name: Proton coupled amino acid transporter 3 (Proton/amino acid transporter 3) (Solute carrier family 36 member 3) (Tramdorin 2)
  • Length: 470  
  • Mass: 51735
  • Tissue specificity: Specifically expressed in testis. {ECO
• Sequence:

  MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIHLLKCNIGTGLLGLPLAIKNAGLLVG
  PVSLLAIGVLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRYTVSFLLVITQLGFC
  SVYFMFMADNLQQMVEKAHVTSNICQPREILTLTPILDIRFYMLIILPFLILLVFIQNLKVLSVFSTLANITTLG
  SMALIFEYIMEGIPYPSNLPLMANWKTFLLFFGTAIFTFEGVGMVLPLKNQMKHPQQFSFVLYLGMSIVIILYIL
  LGTLGYMKFGSDTQASITLNLPNCWLYQSVKLMYSIGIFFTYALQFHVPAEIIIPFAISQVSESWALFVDLSVRS
  ALVCLTCVSAILIPRLDLVISLVGSVSSSALALIIPALLEIVIFYSEDMSCVTIAKDIMISIVGLLGCIFGTYQA
  LYELPQPISHSMANSTGVHA

• Structural information:
  • Interpro: IPR013057  
  • STRING: ENSP00000366942
• Other Databases: GeneCards:  SLC36A3  Malacards:  SLC36A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902600	proton transmembrane transport	IBA	biological process
GO:0035524	proline transmembrane transport	IBA	biological process
GO:0015816	glycine transport	IBA	biological process
GO:0015808	L-alanine transport	IBA	biological process
GO:0015193	L-proline transmembrane transporter activity	IBA	molecular function
GO:0005280	amino acid:proton symporter activity	IBA	molecular function
GO:0015187	glycine transmembrane transporter activity	IBA	molecular function
GO:0015180	L-alanine transmembrane transporter activity	IBA	molecular function
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0005774	vacuolar membrane	IBA	cellular component
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)