• Gene id: 285613

Gene Summary

• Gene Symbol: RELL2   Gene   UCSC   Ensembl
• Aliases: C5orf16
• Gene name: RELT like 2
• Alternate names: RELT-like protein 2, receptor expressed in lymphoid tissues like 2,
• Gene location: 5q31.3 (103715743: 103733667)     Exons: 8     NC_000014.9
• OMIM: 611213

Protein Summary

• Protein general information: Q8NC24  
  • Name: RELT like protein 2
  • Length: 303  
  • Mass: 32405
  • Tissue specificity: Primarily expressed in spleen, thymus, testis, peripheral blood leukocytes, brain and placenta. Not detected in prostate, ovary, small intestine, colon, heart, lung, liver, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNEDTVERI
  VRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGSAAPCLHCSRSKRPPLVRQGRSK
  EGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPE
  RPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEANGQPSKPDTSDHQVSLPQGA
  GSM

• Structural information:
  • Interpro: IPR042313  IPR022248  
  • STRING: ENSP00000297164
• Other Databases: GeneCards:  RELL2  Malacards:  RELL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1900745	positive regulation of p38MAPK cascade	IBA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IBA	biological process
GO:1900745	positive regulation of p38MAPK cascade	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1900745	positive regulation of p38MAPK cascade	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005604	basement membrane	IEA	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0005518	collagen binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881