• Gene id: 285525

Gene Summary

• Gene Symbol: YIPF7   Gene   UCSC   Ensembl
• Aliases: FinGER9
• Gene name: Yip1 domain family member 7
• Alternate names: protein YIPF7, YIP1 family member 7, five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9,
• Gene location: 4p12 (44656867: 44619577)     Exons: 7     NC_000004.12

Protein Summary

• Protein general information: Q8N8F6  
  • Name: Protein YIPF7 (Five pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9) (YIP1 family member 7)
  • Length: 280  
  • Mass: 30632
• Sequence:

  MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASF
  VPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFDEEPPLLEELGIHFDHIWQKTLTVLNPMKPVDGSIMNETDL
  TGPILFCVALGATLLLAGKVQFGYVYGMSAIGCLVIHALLNLMSSSGVSYGCVASVLGYCLLPMVILSGCAMFFS
  LQGIFGIMSSLVIIGWCSLSASKIFIAALHMEGQQLLVAYPCAILYGLFALLTIF

• Structural information:
  • Interpro: IPR006977  
  • STRING: ENSP00000332772
• Other Databases: GeneCards:  YIPF7  Malacards:  YIPF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray