• Gene id: 285386

Gene Summary

• Gene Symbol: TPRG1   Gene   UCSC   Ensembl
• Aliases: FAM79B
• Gene name: tumor protein p63 regulated 1
• Alternate names: tumor protein p63-regulated gene 1 protein, family with sequence similarity 79, member B,
• Gene location: 3q28 (189000778: 189325303)     Exons: 8     NC_000003.12

Protein Summary

• Protein general information: Q6ZUI0  
  • Name: Tumor protein p63 regulated gene 1 protein (Protein FAM79B)
  • Length: 275  
  • Mass: 31230
  • Tissue specificity: Expressed in the epidermal layer of the skin. {ECO
• Sequence:

  MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIE
  TAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPLSAVYRICLGK
  FTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQN
  AHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF

• Structural information:
  • Protein Domains: (68..24-)
    (/note="hSac2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01127"-)
  • Interpro: IPR034753  IPR022158  IPR040242  
  • Prosite: PS51791
  • STRING: ENSP00000341031
• Other Databases: GeneCards:  TPRG1  Malacards:  TPRG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)