• Gene id: 285335

Gene Summary

• Gene Symbol: SLC9C1   Gene   UCSC   Ensembl
• Aliases: NHE, NHE-10, SLC9A10, sperm-NHE
• Gene name: solute carrier family 9 member C1
• Alternate names: sodium/hydrogen exchanger 10, solute carrier family 9, member 10, solute carrier family 9, subfamily C (Na+-transporting carboxylic acid decarboxylase), member 1, sperm-specific Na(+)/H(+) exchanger, sperm-specific sodium proton exchanger,
• Gene location: 3q13.2 (112294257: 112140897)     Exons: 32     NC_000003.12
• Gene summary(Entrez): SLC9A10 is a member of the sodium-hydrogen exchanger (NHE) family (see SLC9A1, MIM 107310) and is required for male fertility and sperm motility (Wang et al., 2003 [PubMed 14634667]).[supplied by OMIM, Apr 2009]
• OMIM: 612738

Protein Summary

• Protein general information: Q4G0N8  
  • Name: Sodium/hydrogen exchanger 10 (Na(+)/H(+) exchanger 10) (NHE 10) (Solute carrier family 9 member 10) (Solute carrier family 9 member C1) (Sperm specific Na(+)/H(+) exchanger) (sNHE)
  • Length: 1177  
  • Mass: 135206
• Sequence:

  MAGIFKEFFFSTEDLPEVILTLSLISSIGAFLNRHLEDFPIPVPVILFLLGCSFEVLSFTSSQVQRYANAIQWMS
  PDLFFRIFTPVVFFTTAFDMDTYMLQKLFWQILLISIPGFLVNYILVLWHLASVNQLLLKPTQWLLFSAILVSSD
  PMLTAAAIRDLGLSRSLISLINGESLMTSVISLITFTSIMDFDQRLQSKRNHTLAEEIVGGICSYIIASFLFGIL
  SSKLIQFWMSTVFGDDVNHISLIFSILYLIFYICELVGMSGIFTLAIVGLLLNSTSFKAAIEETLLLEFWTFLSR
  IAFLMVFTFFGLLIPAHTYLYIEFVDIYYSLNIYLTLIVLRFLTLLLISPVLSRVGHEFSWRWIFIMVCSEMKGM
  PNINMALLLAYSDLYFGSDKEKSQILFHGVLVCLITLVVNRFILPVAVTILGLRDATSTKYKSVCCTFQHFQELT
  KSAASALKFDKDLANADWNMIEKAITLENPYMLNEEETTEHQKVKCPHCNKEIDEIFNTEAMELANRRLLSAQIA
  SYQRQYRNEILSQSAVQVLVGAAESFGEKKGKCMSLDTIKNYSESQKTVTFARKLLLNWVYNTRKEKEGPSKYFF
  FRICHTIVFTEEFEHVGYLVILMNIFPFIISWISQLNVIYHSELKHTNYCFLTLYILEALLKIAAMRKDFFSHAW
  NIFELAITLIGILHVILIEIDTIKYIFNETEVIVFIKVVQFFRILRIFKLIAPKLLQIIDKRMSHQKTFWYGILK
  GYVQGEADIMTIIDQITSSKQIKQMLLKQVIRNMEHAIKELGYLEYDHPEIAVTVKTKEEINVMLNMATEILKAF
  GLKGIISKTEGAGINKLIMAKKKEVLDSQSIIRPLTVEEVLYHIPWLDKNKDYINFIQEKAKVVTFDCGNDIFEE
  GDEPKGIYIIISGMVKLEKSKPGLGIDQMVESKEKDFPIIDTDYMLSGEIIGEINCLTNEPMKYSATCKTVVETC
  FIPKTHLYDAFEQCSPLIKQKMWLKLGLAITARKIREHLSYEDWNYNMQLKLSNIYVVDIPMSTKTDIYDENLIY
  VILIHGAVEDCLLRKTYRAPFLIPITCHQIQSIEDFTKVVIIQTPINMKTFRRNIRKFVPKHKSYLTPGLIGSVG
  TLEEGIQEERNVKEDGAHSAATARSPQPCSLLGTKFNCKESPRINLRKVRKE

• Structural information:
  • Interpro: IPR006153  IPR018422  IPR018490  IPR000595  IPR005821   IPR028483  IPR014710  IPR027359  
  • Prosite: PS50042
  • CDD: cd00038
  • STRING: ENSP00000306627
• Other Databases: GeneCards:  SLC9C1  Malacards:  SLC9C1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015385	sodium:proton antiporter activity	IBA	molecular function
GO:0098719	sodium ion import across plasma membrane	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0015386	potassium:proton antiporter activity	IBA	molecular function
GO:0051453	regulation of intracellular pH	IBA	biological process
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0006812	cation transport	IEA	biological process
GO:0015299	solute:proton antiporter activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)