• Gene id: 285315

Gene Summary

• Gene Symbol: C3orf33   Gene   UCSC   Ensembl
• Aliases: AC3-33
• Gene name: chromosome 3 open reading frame 33
• Alternate names: protein C3orf33, AP-1 activity suppressor,
• Gene location: 3q25.31 (155806286: 155762611)     Exons: 8     NC_000003.12

Protein Summary

• Protein general information: Q6P1S2  
  • Name: Protein C3orf33 (Protein AC3 33)
  • Length: 294  
  • Mass: 33765
  • Tissue specificity: Highly expressed in ileocecal tissue and endometrium. {ECO
• Sequence:

  MAGQPAATGSPSADKDGMEPNVVARISQWADDHLRLVRNISTGMAIAGIMLLLRSIRLTSKFTSSSDIPVEFIRR
  NVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQLLGKEN
  SALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHRNLLKAELTALKKGEGIWKEDSEKESY
  LEKFKDSWREIWKKDSFLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILKFRELISRINFRRKG

• Structural information:
  • Interpro: IPR042421  IPR035437  
• Other Databases: GeneCards:  C3orf33  Malacards:  C3orf33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0051090	regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq