• Gene id: 285242

Gene Summary

• Gene Symbol: HTR3E   Gene   UCSC   Ensembl
• Aliases: 5-HT3-E, 5-HT3E, 5-HT3c1
• Gene name: 5-hydroxytryptamine receptor 3E
• Alternate names: 5-hydroxytryptamine receptor 3E, 5-hydroxytryptamine (serotonin) receptor 3, family member E, 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic, 5-hydroxytryptamine receptor 3 subunit E,
• Gene location: 3q27.1 (184097063: 184106994)     Exons: 9     NC_000003.12
• Gene summary(Entrez): This locus encodes a 5-hydroxytryptamine (serotonin) receptor subunit. The encoded protein, subunit E, may play a role in neurotransmission in myenteric neurons. Genes encoding subunits C, D and E form a cluster on chromosome 3. Alternatively spliced tran
• OMIM: 176257

Protein Summary

• Protein general information: A5X5Y0  
  • Name: 5 hydroxytryptamine receptor 3E (5 HT3 E) (5 HT3E) (Serotonin receptor 3E)
  • Length: 456  
  • Mass: 51438
  • Tissue specificity: Expressed in adult colon and intestine. {ECO
• Sequence:

  MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISFAMSAI
  LDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRI
  RYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATA
  KLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLL
  PTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLT
  PTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITV
  ICLWNT

• Structural information:
  • Interpro: IPR006202  IPR036734  IPR006201  IPR036719  IPR006029   IPR018000  
  • Prosite: PS00236
  • STRING: ENSP00000406050
• Other Databases: GeneCards:  HTR3E  Malacards:  HTR3E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022850	serotonin-gated cation-selective channel activity	IDA	molecular function
GO:0007165	signal transduction	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0022850	serotonin-gated cation-selective channel activity	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0050877	nervous system process	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0005230	extracellular ligand-gated ion channel activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007210	serotonin receptor signaling pathway	IEA	biological process
GO:0007210	serotonin receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04726	Serotonergic synapse
hsa04742	Taste transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq