• Gene id: 285203

Gene Summary

• Gene Symbol: EOGT   Gene   UCSC   Ensembl
• Aliases: AER61, AOS4, C3orf64, EOGT1
• Gene name: EGF domain specific O-linked N-acetylglucosamine transferase
• Alternate names: EGF domain-specific O-linked N-acetylglucosamine transferase, AER61 glycosyltransferase, EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase, EGF-O-GlcNAc transferase, extracellular O-linked N-acetylglucosamine transferase,
• Gene location: 3p14.1 (69013960: 68975219)     Exons: 21     NC_000003.12
• Gene summary(Entrez): This gene encodes an enzyme that acts in the lumen of the endoplasmic reticulum to catalyze the transfer of N-acetylglucosamine to serine or threonine residues of extracellular-targeted proteins. This enzyme modifies proteins containing eukaryotic growth
• OMIM: 607651

Protein Summary

• Protein general information: Q5NDL2  
  • Name: EGF domain specific O linked N acetylglucosamine transferase (EC 2.4.1.255) (Extracellular O linked N acetylglucosamine transferase)
  • Length: 527  
  • Mass: 62011
• Sequence:

  MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATVCRKDSLCPYKKHLEK
  LKYCWGYEKSCKPEFRFGYPVCSYVDMGWTDTLESAEDIFWKQADFGYARERLEEMHVLCQPKETSDSSLVCSRY
  LQYCRATNLYLDLRNIKRNHDRFKEDFFQSGEIGGHCKLDIRTLTSEGQRKSPLQSWFAELQSYTQLNFRPIEDA
  KCDIVIEKPTYFMKLDAGVNMYHHFCDFINLYITQHVNNSFSTDVYIVMWDTSSYGYGDLFSDTWNAFTDYDVIH
  LKTYDSKRVCFKEAVFSLLPRMRYGLFYNTPLISGCQNTGLFRAFAQHVLHRLNITQEGPKDGKIRVTILARSTE
  YRKILNQNELVNALKTVSTFEVQIVDYKYRELGFLDQLRITHNTDIFIGMHGAGLTHLLFLPDWAAVFELYNCED
  ERCYLDLARLRGVHYITWRRQNKVFPQDKGHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHD
  EL

• Structural information:
  • Interpro: IPR007657  
  • Prosite: PS00014
  • STRING: ENSP00000373206
• Other Databases: GeneCards:  EOGT  Malacards:  EOGT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016757	transferase activity, transferring glycosyl groups	IBA	molecular function
GO:0005788	endoplasmic reticulum lumen	IBA	cellular component
GO:0016262	protein N-acetylglucosaminyltransferase activity	IBA	molecular function
GO:0097370	protein O-GlcNAcylation via threonine	IBA	biological process
GO:0016262	protein N-acetylglucosaminyltransferase activity	ISS	molecular function
GO:0006493	protein O-linked glycosylation	ISS	biological process
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0097363	protein O-GlcNAc transferase activity	IEA	molecular function
GO:0006493	protein O-linked glycosylation	IEA	biological process
GO:0016262	protein N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00514	Other types of O-glycan biosynthesis

Diseases

Associated diseases	References
Adams-Oliver syndrome	KEGG:H01413
Adams-Oliver syndrome	KEGG:H01413
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881