• Gene id: 2852

Gene Summary

• Gene Symbol: GPER1   Gene   UCSC   Ensembl
• Aliases: CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br, GPER, GPR30, LERGU, LERGU2, LyGPR, mER
• Gene name: G protein-coupled estrogen receptor 1
• Alternate names: G-protein coupled estrogen receptor 1, G protein-coupled receptor 30, IL8-related receptor DRY12, chemoattractant receptor-like 2, chemokine receptor-like 2, constitutively expressed peptide-like receptor, flow-induced endothelial G-protein coupled receptor 1, h,
• Gene location: 7p22.3 (1086806: 1093814)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum and a member of the G-protein coupled receptor 1 family. This receptor binds estrogen and activates multiple downstream signaling pathways, leading to stimulation
• OMIM: 601805

Protein Summary

• Protein general information: Q99527  
  • Name: G protein coupled estrogen receptor 1 (Chemoattractant receptor like 2) (Flow induced endothelial G protein coupled receptor 1) (FEG 1) (G protein coupled estrogen receptor 1) (G protein coupled receptor 30) (GPCR Br) (IL8 related receptor DRY12) (Lymphoc
  • Length: 375  
  • Mass: 42248
  • Tissue specificity: Expressed in placenta, endothelial and epithelial cells, non laboring and laboring term myometrium, fibroblasts and cancer-associated fibroblasts (CAF), prostate cancer cells and invasive adenocarcinoma (at protein level). Ubiquitously
• Sequence:

  MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFV
  GNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTW
  MSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIV
  PFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRH
  AHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000380281
• Other Databases: GeneCards:  GPER1  Malacards:  GPER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030284	estrogen receptor activity	IBA	molecular function
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0030518	intracellular steroid hormone receptor signaling pathway	IBA	biological process
GO:0071392	cellular response to estradiol stimulus	IBA	biological process
GO:0043401	steroid hormone mediated signaling pathway	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071392	cellular response to estradiol stimulus	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0055037	recycling endosome	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IDA	cellular component
GO:0030518	intracellular steroid hormone receptor signaling pathway	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:1990239	steroid hormone binding	IDA	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IDA	biological process
GO:0071375	cellular response to peptide hormone stimulus	IDA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045745	positive regulation of G protein-coupled receptor signaling pathway	IDA	biological process
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IDA	biological process
GO:0045095	keratin filament	IDA	cellular component
GO:0032962	positive regulation of inositol trisphosphate biosynthetic process	IDA	biological process
GO:0030284	estrogen receptor activity	IDA	molecular function
GO:0030284	estrogen receptor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	NOT|cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005496	steroid binding	IDA	molecular function
GO:0005496	steroid binding	IDA	molecular function
GO:0002695	negative regulation of leukocyte activation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	ISS	biological process
GO:0071389	cellular response to mineralocorticoid stimulus	ISS	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0071157	negative regulation of cell cycle arrest	ISS	biological process
GO:0051480	regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0051055	negative regulation of lipid biosynthetic process	ISS	biological process
GO:0050769	positive regulation of neurogenesis	ISS	biological process
GO:0097755	positive regulation of blood vessel diameter	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	biological process
GO:0042734	presynaptic membrane	ISS	cellular component
GO:0032591	dendritic spine membrane	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030264	nuclear fragmentation involved in apoptotic nuclear change	ISS	biological process
GO:0030263	apoptotic chromosome condensation	ISS	biological process
GO:0019228	neuronal action potential	ISS	biological process
GO:0003707	steroid hormone receptor activity	ISS	molecular function
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0001956	positive regulation of neurotransmitter secretion	ISS	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	ISS	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0051053	negative regulation of DNA metabolic process	ISS	biological process
GO:0048786	presynaptic active zone	ISS	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0044327	dendritic spine head	ISS	cellular component
GO:0043679	axon terminus	ISS	cellular component
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0043198	dendritic shaft	ISS	cellular component
GO:0043065	positive regulation of apoptotic process	ISS	biological process
GO:0032024	positive regulation of insulin secretion	ISS	biological process
GO:0031966	mitochondrial membrane	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0010629	negative regulation of gene expression	ISS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:2000724	positive regulation of cardiac vascular smooth muscle cell differentiation	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010948	negative regulation of cell cycle process	IMP	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IMP	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:1904706	negative regulation of vascular smooth muscle cell proliferation	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071157	negative regulation of cell cycle arrest	IEA	biological process
GO:0051055	negative regulation of lipid biosynthetic process	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0030284	estrogen receptor activity	IEA	molecular function
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04915	Estrogen signaling pathway
hsa01522	Endocrine resistance
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Endometriosis	INFBASE: 22520060
Female infertility	INFBASE: 23458722
Ovarian endometriosis	INFBASE: 26333495
Polycystic ovary syndrome (PCOS)	INFBASE: 26649621
Male factor infertility	MIK: 25052196
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray