• Gene id: 28514

Gene Summary

• Gene Symbol: DLL1   Gene   UCSC   Ensembl
• Aliases: DELTA1, DL1, Delta, NEDBAS
• Gene name: delta like canonical Notch ligand 1
• Alternate names: delta-like protein 1, H-Delta-1, drosophila Delta homolog 1, epididymis secretory sperm binding protein,
• Gene location: 6q27 (170291077: 170282199)     Exons: 11     NC_000006.12
• Gene summary(Entrez): DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq, Jul 2008]
• OMIM: 605881

Protein Summary

• Protein general information: O00548  
  • Name: Delta like protein 1 (Drosophila Delta homolog 1) (Delta1) (H Delta 1)
  • Length: 723  
  • Mass: 78056
  • Tissue specificity: Expressed in heart and pancreas, with lower expression in brain and muscle and almost no expression in placenta, lung, liver and kidney.
• Sequence:

  MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEP
  PCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQ
  RHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPI
  CLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
  GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPC
  FNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASS
  PCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPP
  GPAVVDLTEKLEGQGGPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
  DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEK
  GTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIATEV

• Structural information:
  • Protein Domains: (177..22-)
    (/note="DSL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00377-)
    (226..25-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (257..28-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU000-)
  • Interpro: IPR001774  IPR001881  IPR013032  IPR000742  IPR000152   IPR018097  IPR009030  IPR011651  
  • Prosite: PS00010 PS51051 PS00022 PS01186 PS50026 PS01187
  • PDB: 4XBM
  • PDBsum: 4XBM
  • STRING: ENSP00000355718
• Other Databases: GeneCards:  DLL1  Malacards:  DLL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005112	Notch binding	IBA	molecular function
GO:0007219	Notch signaling pathway	IBA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030957	Tat protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060042	retina morphogenesis in camera-type eye	ISS	biological process
GO:0045665	negative regulation of neuron differentiation	ISS	biological process
GO:0035265	organ growth	ISS	biological process
GO:1903672	positive regulation of sprouting angiogenesis	ISS	biological process
GO:0072583	clathrin-dependent endocytosis	ISS	biological process
GO:0001756	somitogenesis	ISS	biological process
GO:0097150	neuronal stem cell population maintenance	ISS	biological process
GO:0072006	nephron development	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0021688	cerebellar molecular layer formation	ISS	biological process
GO:0009954	proximal/distal pattern formation	ISS	biological process
GO:0003323	type B pancreatic cell development	ISS	biological process
GO:0051302	regulation of cell division	ISS	biological process
GO:0030857	negative regulation of epithelial cell differentiation	ISS	biological process
GO:0097009	energy homeostasis	ISS	biological process
GO:0040008	regulation of growth	ISS	biological process
GO:0060853	Notch signaling pathway involved in arterial endothelial cell fate commitment	ISS	biological process
GO:0046331	lateral inhibition	ISS	biological process
GO:0050767	regulation of neurogenesis	ISS	biological process
GO:0048665	neuron fate specification	ISS	biological process
GO:0098773	skin epidermis development	ISS	biological process
GO:0002315	marginal zone B cell differentiation	ISS	biological process
GO:0060041	retina development in camera-type eye	ISS	biological process
GO:0021510	spinal cord development	ISS	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0097102	endothelial tip cell fate specification	ISS	biological process
GO:0045747	positive regulation of Notch signaling pathway	ISS	biological process
GO:0005912	adherens junction	ISS	cellular component
GO:0014807	regulation of somitogenesis	ISS	biological process
GO:0005112	Notch binding	IPI	molecular function
GO:0045807	positive regulation of endocytosis	ISS	biological process
GO:0048633	positive regulation of skeletal muscle tissue growth	ISS	biological process
GO:0034351	negative regulation of glial cell apoptotic process	ISS	biological process
GO:0021693	cerebellar Purkinje cell layer structural organization	ISS	biological process
GO:0014002	astrocyte development	ISS	biological process
GO:0007219	Notch signaling pathway	ISS	biological process
GO:0048630	skeletal muscle tissue growth	ISS	biological process
GO:0045596	negative regulation of cell differentiation	ISS	biological process
GO:0008217	regulation of blood pressure	ISS	biological process
GO:1900746	regulation of vascular endothelial growth factor signaling pathway	ISS	biological process
GO:0045747	positive regulation of Notch signaling pathway	ISS	biological process
GO:0045605	negative regulation of epidermal cell differentiation	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0048631	regulation of skeletal muscle tissue growth	ISS	biological process
GO:0045662	negative regulation of myoblast differentiation	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0007154	cell communication	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:2000726	negative regulation of cardiac muscle cell differentiation	IEA	biological process
GO:1900746	regulation of vascular endothelial growth factor signaling pathway	IEA	biological process
GO:0097102	endothelial tip cell fate specification	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0048633	positive regulation of skeletal muscle tissue growth	IEA	biological process
GO:0048631	regulation of skeletal muscle tissue growth	IEA	biological process
GO:0048630	skeletal muscle tissue growth	IEA	biological process
GO:0045807	positive regulation of endocytosis	IEA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0045605	negative regulation of epidermal cell differentiation	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0034351	negative regulation of glial cell apoptotic process	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0021693	cerebellar Purkinje cell layer structural organization	IEA	biological process
GO:0021510	spinal cord development	IEA	biological process
GO:0014807	regulation of somitogenesis	IEA	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0007267	cell-cell signaling	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005912	adherens junction	IEA	cellular component
GO:0005112	Notch binding	IEA	molecular function
GO:0001947	heart looping	IEA	biological process
GO:1903672	positive regulation of sprouting angiogenesis	IEA	biological process
GO:0098773	skin epidermis development	IEA	biological process
GO:0097150	neuronal stem cell population maintenance	IEA	biological process
GO:0097110	scaffold protein binding	IEA	molecular function
GO:0097009	energy homeostasis	IEA	biological process
GO:0072070	loop of Henle development	IEA	biological process
GO:0072014	proximal tubule development	IEA	biological process
GO:0072006	nephron development	IEA	biological process
GO:0070986	left/right axis specification	IEA	biological process
GO:0060853	Notch signaling pathway involved in arterial endothelial cell fate commitment	IEA	biological process
GO:0060042	retina morphogenesis in camera-type eye	IEA	biological process
GO:0051302	regulation of cell division	IEA	biological process
GO:0050767	regulation of neurogenesis	IEA	biological process
GO:0048839	inner ear development	IEA	biological process
GO:0048665	neuron fate specification	IEA	biological process
GO:0046331	lateral inhibition	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0045608	negative regulation of inner ear auditory receptor cell differentiation	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0035265	organ growth	IEA	biological process
GO:0030857	negative regulation of epithelial cell differentiation	IEA	biological process
GO:0021688	cerebellar molecular layer formation	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0009954	proximal/distal pattern formation	IEA	biological process
GO:0007386	compartment pattern specification	IEA	biological process
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0003323	type B pancreatic cell development	IEA	biological process
GO:0002315	marginal zone B cell differentiation	IEA	biological process
GO:0001757	somite specification	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0001947	heart looping	ISS	biological process
GO:0007368	determination of left/right symmetry	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030154	cell differentiation	TAS	biological process
GO:0007219	Notch signaling pathway	NAS	biological process
GO:0001709	cell fate determination	NAS	biological process
GO:0032693	negative regulation of interleukin-10 production	IMP	biological process
GO:0097150	neuronal stem cell population maintenance	IEP	biological process
GO:0030097	hemopoiesis	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030155	regulation of cell adhesion	TAS	biological process
GO:0007219	Notch signaling pathway	IMP	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0005112	Notch binding	IPI	molecular function
GO:0005112	Notch binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05224	Breast cancer
hsa04658	Th1 and Th2 cell differentiation
hsa01522	Endocrine resistance
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
Temporal arteritis	PMID:21220737
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq