• Gene id: 285051

Gene Summary

• Gene Symbol: STPG4   Gene   UCSC   Ensembl
• Aliases: C2orf61, GSE
• Gene name: sperm-tail PG-rich repeat containing 4
• Alternate names: protein STPG4, gonad-specific expression gene protein, sperm-tail PG-rich repeat-containing protein 4, uncharacterized protein C2orf61,
• Gene location: 2p21 (47155307: 47086990)     Exons: 7     NC_000002.12
• OMIM: 604295

Protein Summary

• Protein general information: Q8N801  
  • Name: Protein STPG4 (Gonad specific expression gene protein) (GSE) (Sperm tail PG rich repeat containing protein 4)
  • Length: 248  
  • Mass: 27807
• Sequence:

  MDQPAVATASTSIREDLVGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNF
  KNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVDKDQSLQLSPGQYNVLPAPVP
  KYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMPPTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQ
  SPTIAKMGQEHSLFFNNNNWLLK

• Structural information:
  • Interpro: IPR010736  IPR039345  
  • STRING: ENSP00000408527
• Other Databases: GeneCards:  STPG4  Malacards:  STPG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	ISS	molecular function
GO:0044727	DNA demethylation of male pronucleus	ISS	biological process
GO:0042585	germinal vesicle	ISS	cellular component
GO:0001940	male pronucleus	ISS	cellular component
GO:0001939	female pronucleus	ISS	cellular component
GO:1901537	positive regulation of DNA demethylation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:1901537	positive regulation of DNA demethylation	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0042393	histone binding	IEA	molecular function
GO:0044727	DNA demethylation of male pronucleus	IEA	biological process
GO:0001939	female pronucleus	IEA	cellular component
GO:0001940	male pronucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042585	germinal vesicle	IEA	cellular component
GO:0090116	C-5 methylation of cytosine	IEA	biological process
GO:1901537	positive regulation of DNA demethylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq