• Gene id: 285

Gene Summary

• Gene Symbol: ANGPT2   Gene   UCSC   Ensembl
• Aliases: AGPT2, ANG2
• Gene name: angiopoietin 2
• Alternate names: angiopoietin-2, ANG-2, Tie2-ligand, angiopoietin-2B, angiopoietin-2a,
• Gene location: 8p23.1 (6563419: 6499631)     Exons: 9     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is an antagonist of angiopoietin 1 (Ang-1), and both (Ang-1 and Ang-2) are ligands for the endothelial tyrosine kinase receptor (Tie2). These two ligands affect angiogenesis during embryogenesis and tumorigenesis. The enco
• OMIM: 601922

SNPs

rs4045481

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000004.12   g.1096837G>A
NC_000004.11   g.1090625G>A
NG_027812.2   g.21958C>T
NG_027812.1   g.21728C>T
NM_001131034.4   c.174C>T
NM_001131034.3   c.174C>T
NM_194439.4   c.174C>T
NM_001193318.3   c.174C>T
NM_001193318.2   c.174C>T
NR_159501.1   n.486C>T
NR_159498.1   n.

rs1801085

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.27128971A>G
NC_000007.13   g.27168590A>G
NM_002141.4   c.*254T>C
NM_002141.5   c.*254T>C|SEQ=[A/G]|GENE=HOXA3
HOXA4   3201
HOXA-AS2   285943

Protein Summary

• Protein general information: O15123  
  • Name: Angiopoietin 2 (ANG 2)
  • Length: 496  
  • Mass: 56919
• Sequence:

  MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDD
  SVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVL
  NQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNS
  IIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
  TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHL
  KDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDAC
  GPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

• Structural information:
  • Protein Domains: (275..49-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR028844  IPR036056  IPR014716  IPR014715  IPR002181   IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • PDB: 1Z3S 1Z3U 2GY7 4JZC 4ZFG
  • PDBsum: 1Z3S 1Z3U 2GY7 4JZC 4ZFG
  • DIP: 6048
  • STRING: ENSP00000314897
• Other Databases: GeneCards:  ANGPT2  Malacards:  ANGPT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0031589	cell-substrate adhesion	IBA	biological process
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0048014	Tie signaling pathway	IBA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0010467	gene expression	IDA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0014823	response to activity	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001666	response to hypoxia	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IEA	biological process
GO:0072012	glomerulus vasculature development	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0031100	animal organ regeneration	IEA	biological process
GO:0009314	response to radiation	IEA	biological process
GO:0007281	germ cell development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0050928	negative regulation of positive chemotaxis	IDA	biological process
GO:0048014	Tie signaling pathway	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0072012	glomerulus vasculature development	ISS	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Transitional cell carcinoma	PMID:15705099
Endometrial adenocarcinoma	PMID:17295646
type 2 diabetes mellitus	PMID:15823283
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881