Search Result
Gene id | 284805 | ||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
Gene Symbol | C20orf203 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
Gene name | chromosome 20 open reading frame 203 | ||||||||||||||||||||||||||||||||
Alternate names | uncharacterized protein C20orf203, alugen, | ||||||||||||||||||||||||||||||||
Gene location |
20q11.21 (32673940: 32631624) Exons: 6 NC_000020.11 |
||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The protein encoded by this gene is thought to be a human-specific protein. Currently available evidence suggests that orthologous regions in other organisms contain sequence differences that would not support production of a protein product. Genome-wide |
||||||||||||||||||||||||||||||||
OMIM | 606683 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
Protein general information | Q8NBC4 Name: Uncharacterized protein C20orf203 Length: 194 Mass: 21159 Tissue specificity: Expressed most abundantly in the brain at protein level. Present in cortex, cerebellum and midbrain. Found in neurons. Elevated expressions detected in Alzheimer brain samples. Also expressed in testis. {ECO | ||||||||||||||||||||||||||||||||
Sequence |
MFPRPVLNSRAQAILLPQPPNMLDHRQWPPRLASFPFTKTGMLSRATSVLAGLTAHLWDLGGGAGRRTSKAQRVH PQPSHQRQPPPPQHPGPYQERIWVGGEGWGEVGGLRLSKVGRRDREVGRGLRAPAGRGRAMGGMPRMGTVGDFGQ ALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSRSLFN | ||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||
Other Databases | GeneCards: C20orf203 Malacards: C20orf203 | ||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||
|