• Gene id: 2847

Gene Summary

• Gene Symbol: MCHR1   Gene   UCSC   Ensembl
• Aliases: GPR24, MCH-1R, MCH1R, SLC-1, SLC1
• Gene name: melanin concentrating hormone receptor 1
• Alternate names: melanin-concentrating hormone receptor 1, G protein-coupled receptor 24, MCH receptor 1, somatostatin receptor-like protein,
• Gene location: 22q13.2 (40679177: 40682813)     Exons: 13     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium
• OMIM: 601751

Protein Summary

• Protein general information: Q99705  
  • Name: Melanin concentrating hormone receptor 1 (MCH receptor 1) (MCH R1) (MCHR 1) (G protein coupled receptor 24) (MCH 1R) (MCH1R) (MCHR) (SLC 1) (Somatostatin receptor like protein)
  • Length: 422  
  • Mass: 45963
  • Tissue specificity: Highest level in brain, particularly in the frontal cortex and hypothalamus, lower levels in the liver and heart.
• Sequence:

  MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEAS
  LLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIF
  IINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRK
  PSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
  LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCL
  NPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR004047  IPR008361  
  • Prosite: PS50262
  • STRING: ENSP00000249016
• Other Databases: GeneCards:  MCHR1  Malacards:  MCHR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0042277	peptide binding	IBA	molecular function
GO:0042923	neuropeptide binding	IBA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030273	melanin-concentrating hormone receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0008188	neuropeptide receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007631	feeding behavior	TAS	biological process
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0005929	cilium	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0051928	positive regulation of calcium ion transport	IEA	biological process
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0097731	9+0 non-motile cilium	IEA	cellular component
GO:0097730	non-motile cilium	IEA	cellular component
GO:0042562	hormone binding	IEA	molecular function
GO:0030273	melanin-concentrating hormone receptor activity	IEA	molecular function
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0060170	ciliary membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0097730	non-motile cilium	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
morbid obesity	PMID:16186414
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq