• Gene id: 284695

Gene Summary

• Gene Symbol: ZNF326   Gene   UCSC   Ensembl
• Aliases: ZAN75, ZIRD, Zfp326, dJ871E2.1
• Gene name: zinc finger protein 326
• Alternate names: DBIRD complex subunit ZNF326, ZNF-protein interacting with nuclear mRNPs and DBC1, dJ871E2.1 (novel protein (ortholog of mouse zinc finger protein Zan75)), zinc finger protein interacting with mRNPs and DBC1,
• Gene location: 1p22.2 (89995094: 90035532)     Exons: 12     NC_000001.11

Protein Summary

• Protein general information: Q5BKZ1  
  • Name: DBIRD complex subunit ZNF326 (Zinc finger protein 326) (Zinc finger protein interacting with mRNPs and DBC1)
  • Length: 582  
  • Mass: 65654
• Sequence:

  MDFEDDYTHSACRNTYQGFNGMDRDYGPGSYGGMDRDYGHGSYGGQRSMDSYLNQSYGMDNHSGGGGGSRFGPYE
  SYDSRSSLGGRDLYRSGYGFNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRG
  RENYSSYSSFSSPHMKPAPVGSRGRGTPAYPESTFGSRNYDAFGGPSTGRGRGRGHMGDFGSIHRPGIVVDYQNK
  STNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKISLSKSPTKTDPKNEEEEKRRIEARREKQRRRREKN
  SEKYGDGYRMAFTCSFCKFRTFEEKDIELHLESSSHQETLDHIQKQTKFDKVVMEFLHECMVNKFKKTSIRKQQT
  NNQTEVVKIIEKDVMEGVTVDDHMMKVETVHCSACSVYIPALHSSVQQHLKSPDHIKGKQAYKEQIKRESVLTAT
  SILNNPIVKARYERFVKGENPFEIQDHSQDQQIEGDEEDEEKIDEPIEEEEDEDEEEEAEEVGEVEEVEEVEEVR
  EGGIEGEGNIQGVGEGGEVGVVGEVEGVGEVEEVEELEEETAKEEPADFPVEQPEEN

• Structural information:
  • Interpro: IPR007071  IPR034736  
  • Prosite: PS51799
  • STRING: ENSP00000340796
• Other Databases: GeneCards:  ZNF326  Malacards:  ZNF326

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016363	nuclear matrix	IBA	cellular component
GO:0032784	regulation of DNA-templated transcription, elongation	IBA	biological process
GO:0044609	DBIRD complex	IBA	cellular component
GO:0000993	RNA polymerase II complex binding	IBA	molecular function
GO:0044609	DBIRD complex	IDA	cellular component
GO:0000993	RNA polymerase II complex binding	IDA	molecular function
GO:0032784	regulation of DNA-templated transcription, elongation	IMP	biological process
GO:0043484	regulation of RNA splicing	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881