• Gene id: 284467

Gene Summary

• Gene Symbol: TAFA3   Gene   UCSC   Ensembl
• Aliases: FAM19A3, TAFA-3
• Gene name: TAFA chemokine like family member 3
• Alternate names: chemokine-like protein TAFA-3, family with sequence similarity 19 (chemokine (C-C motif)-like), member A3, family with sequence similarity 19 member A3, C-C motif chemokine like, protein FAM19A3,
• Gene location: 1p13.2 (112718960: 112727234)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the
• OMIM: 611123

Protein Summary

• Protein general information: Q7Z5A8  
  • Name: Chemokine like protein TAFA 3
  • Length: 133  
  • Mass: 14776
  • Tissue specificity: Brain-specific. {ECO
• Sequence:

  MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRIEERSQTVKCSCFSGQ
  VAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSCSSGHKVKTTKVTR

• Structural information:
  • Interpro: IPR020350  
  • STRING: ENSP00000358644
• Other Databases: GeneCards:  TAFA3  Malacards:  TAFA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903980	positive regulation of microglial cell activation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:1903979	negative regulation of microglial cell activation	IBA	biological process
GO:0048018	receptor ligand activity	IBA	molecular function
GO:1903980	positive regulation of microglial cell activation	ISS	biological process
GO:1903979	negative regulation of microglial cell activation	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq