About Us

Search Result


Gene id 284439
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol SLC25A42   Gene   UCSC   Ensembl
Aliases MECREN
Gene name solute carrier family 25 member 42
Alternate names mitochondrial coenzyme A transporter SLC25A42,
Gene location 19p13.11 (19063993: 19113029)     Exons: 10     NC_000019.10
Gene summary(Entrez) This gene encodes a solute carrier family 25 protein. Solute carrier family 25 proteins are localized to mitochondria and play critical roles in the transport of molecules across the inner mitochondrial membrane. The encoded protein is a mitochondrial tra
OMIM 617497

Protein Summary

Protein general information Q86VD7  

Name: Mitochondrial coenzyme A transporter SLC25A42 (Solute carrier family 25 member 42)

Length: 318  Mass: 35409

Sequence MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFR
VLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGALAGTTAASLTY
PLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPY
PFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVG
ISFTTFDLMQILLRHLQS
Structural information
Interpro:  IPR014762  IPR002167  IPR002067  IPR018108  IPR023395  
Prosite:   PS50920
STRING:   ENSP00000326693
Other Databases GeneCards:  SLC25A42  Malacards:  SLC25A42

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0080121 AMP transport
IDA biological process
GO:0015867 ATP transport
IDA biological process
GO:0015866 ADP transport
IDA biological process
GO:0005347 ATP transmembrane transpo
rter activity
IDA molecular function
GO:0080122 AMP transmembrane transpo
rter activity
IDA molecular function
GO:0043262 adenosine-diphosphatase a
ctivity
IDA molecular function
GO:0035349 coenzyme A transmembrane
transport
IDA biological process
GO:0015228 coenzyme A transmembrane
transporter activity
IDA molecular function
GO:0015217 ADP transmembrane transpo
rter activity
IDA molecular function
GO:0005739 mitochondrion
IDA cellular component
GO:0005347 ATP transmembrane transpo
rter activity
IEA molecular function
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0055085 transmembrane transport
IEA biological process
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0005739 mitochondrion
IEA cellular component
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005743 mitochondrial inner membr
ane
IEA cellular component
GO:0005739 mitochondrion
IDA cellular component
GO:0005634 nucleus
HDA cellular component
Associated diseases References
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract