• Gene id: 284415

Gene Summary

• Gene Symbol: VSTM1   Gene   UCSC   Ensembl
• Aliases: SIRL-1, SIRL1, UNQ3033
• Gene name: V-set and transmembrane domain containing 1
• Alternate names: V-set and transmembrane domain-containing protein 1, LAIR homolog, OSCAR-like transcript-1, signal inhibitory receptor on leukocytes-1,
• Gene location: 19q13.42 (54063965: 54040824)     Exons: 13     NC_000019.10
• OMIM: 610962

Protein Summary

• Protein general information: Q6UX27  
  • Name: V set and transmembrane domain containing protein 1 (Signal inhibitory receptor on leukocytes 1) (SIRL 1)
  • Length: 236  
  • Mass: 26109
  • Tissue specificity: Expressed on myeloid (neutrophils, eosinophils and monocytes) but not on lymphoid cells. {ECO
• Sequence:

  MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSA
  ENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLF
  LSVFIIYRCSQHSSSSEESTKRTSHSKLPEQEAAEADLSNMERVSLSTADPQGVTYAELSTSALSEAASDTTQEP
  PGSHEYAALKV

• Structural information:
  • Protein Domains: (27..11-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • STRING: ENSP00000343366
• Other Databases: GeneCards:  VSTM1  Malacards:  VSTM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq