• Gene id: 2844

Gene Summary

• Gene Symbol: GPR21   Gene   UCSC   Ensembl
• Gene name: G protein-coupled receptor 21
• Alternate names: probable G-protein coupled receptor 21,
• Gene location: 9q33.2 (123033634: 123042750)     Exons: 2     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the G-protein-coupled receptor 1 family. G-protein coupled receptors are membrane proteins which activate signaling cascades as a response to extracellular stress. The encoded protein activates a Gq signal transduction pathwa
• OMIM: 604837

SNPs

rs55763075

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.11790377C>T
NC_000001.10   g.11850434C>T
NG_013351.1   g.20727G>A
NM_005957.5   c.*303G>A
NM_005957.4   c.*303G>A
NM_001330358.1   c.*303G>A
XM_005263460.5   c.*303G>A
XM_005263460.1   c.*303G>A
XM_005263463.4   c.*303G>A
XM_005263463.1   c.*303G>A
XM_0  

Protein Summary

• Protein general information: Q99679  
  • Name: Probable G protein coupled receptor 21
  • Length: 349  
  • Mass: 39515
  • Tissue specificity: Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus, hippocampus.
• Sequence:

  MNSTLDGNQSSHPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVFHCAPLLNHHTTSYFIQTMAYAD
  LFVGVSCVVPSLSLLHHPLPVEESLTCQIFGFVVSVLKSVSMASLACISIDRYIAITKPLTYNTLVTPWRLRLCI
  FLIWLYSTLVFLPSFFHWGKPGYHGDVFQWCAESWHTDSYFTLFIVMMLYAPAALIVCFTYFNIFRICQQHTKDI
  SERQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGHSNRFASFLTTWLAISNSFCN
  CVIYSLSNSVFQRGLKRLSGAMCTSCASQTTANDPYTVRSKGPLNGCHI

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000362746
• Other Databases: GeneCards:  GPR21  Malacards:  GPR21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001594	trace-amine receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0001594	trace-amine receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881