• Gene id: 284366

Gene Summary

• Gene Symbol: KLK9   Gene   UCSC   Ensembl
• Aliases: KLK-L3, KLKL3
• Gene name: kallikrein related peptidase 9
• Alternate names: kallikrein-9, kallikrein-like protein 3,
• Gene location: 19q13.41 (51009591: 51002507)     Exons: 5     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a kallikrein-related serine protease. This gene is activated by steroid hormones in a human breast cancer cell line, making it a good marker for cancer detection. The encoded protein is found primarily in the cytoplasm.
• OMIM: 605504

Protein Summary

• Protein general information: Q9UKQ9  
  • Name: Kallikrein 9 (EC 3.4.21. ) (Kallikrein like protein 3) (KLK L3)
  • Length: 250  
  • Mass: 27513
  • Tissue specificity: Skin, thymus, trachea, cerebellum and spinal cord.
• Sequence:

  MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLWVRLGE
  HHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGA
  VSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPC
  SRPRRPAVYTSVCHYLDWIQEIMEN

• Structural information:
  • Protein Domains: (23..24-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000469417
• Other Databases: GeneCards:  KLK9  Malacards:  KLK9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004252	serine-type endopeptidase activity	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)