Search Result
Gene id | 284366 | ||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | KLK9 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
Aliases | KLK-L3, KLKL3 | ||||||||||||||||||||||||||||||||||||||||||||
Gene name | kallikrein related peptidase 9 | ||||||||||||||||||||||||||||||||||||||||||||
Alternate names | kallikrein-9, kallikrein-like protein 3, | ||||||||||||||||||||||||||||||||||||||||||||
Gene location |
19q13.41 (51009591: 51002507) Exons: 5 NC_000019.10 |
||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The protein encoded by this gene is a kallikrein-related serine protease. This gene is activated by steroid hormones in a human breast cancer cell line, making it a good marker for cancer detection. The encoded protein is found primarily in the cytoplasm. |
||||||||||||||||||||||||||||||||||||||||||||
OMIM | 605504 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q9UKQ9 Name: Kallikrein 9 (EC 3.4.21. ) (Kallikrein like protein 3) (KLK L3) Length: 250 Mass: 27513 Tissue specificity: Skin, thymus, trachea, cerebellum and spinal cord. | ||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLWVRLGE HHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGA VSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPC SRPRRPAVYTSVCHYLDWIQEIMEN | ||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: KLK9 Malacards: KLK9 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
|