• Gene id: 284348

Gene Summary

• Gene Symbol: LYPD5   Gene   UCSC   Ensembl
• Aliases: PRO4356
• Gene name: LY6/PLAUR domain containing 5
• Alternate names: ly6/PLAUR domain-containing protein 5, metastasis-associated protein,
• Gene location: 19q13.31 (43820655: 43795926)     Exons: 6     NC_000019.10
• OMIM: 611923

Protein Summary

• Protein general information: Q6UWN5  
  • Name: Ly6/PLAUR domain containing protein 5
  • Length: 251  
  • Mass: 26936
• Sequence:

  MAMGVPRVILLCLFGAALCLTGSQALQCYSFEHTYFGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRK
  GCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIGVHQDDCAIGR
  SRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGTTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSA
  SATTPPRALQVLALLLPVLLLVGLSA

• Structural information:
  • Protein Domains: (135..21-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR018363  IPR016054  
  • Prosite: PS00983
  • STRING: ENSP00000367185
• Other Databases: GeneCards:  LYPD5  Malacards:  LYPD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0043236	laminin binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray