• Gene id: 284297

Gene Summary

• Gene Symbol: SSC5D   Gene   UCSC   Ensembl
• Aliases: S5D-SRCRB
• Gene name: scavenger receptor cysteine rich family member with 5 domains
• Alternate names: soluble scavenger receptor cysteine-rich domain-containing protein SSC5D, scavenger receptor cysteine rich domain containing (5 domains), scavenger receptor cysteine rich family, 5 domains, scavenger receptor cysteine-rich glycoprotein, soluble scavenger prot,
• Gene location: 19q13.42 (55488435: 55519098)     Exons: 15     NC_000019.10
• OMIM: 615002

Protein Summary

• Protein general information: A1L4H1  
  • Name: Soluble scavenger receptor cysteine rich domain containing protein SSC5D (Soluble scavenger protein with 5 SRCR domains) (SSc5D)
  • Length: 1573  
  • Mass: 165743
  • Tissue specificity: Highly expressed in monocytes/macrophages and T-lymphocytes. Highly expressed in placenta and spleen, and also detected at lower levels in colon, and more weakly in lung, heart and kidney. {ECO
• Sequence:

  MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQLGCGGALAAPGGAFF
  GEGAGPVWLSELACRGNEGQLGLCHHRGWKAHICSHEEDAGVVCAGQRVANSRDDSTSPLDGAPWPGLLLELSPS
  TEEPLVTHAPRPAGNPQNASRKKSPRPKQAKSTRAPLLTTGAPRQERLRLVSGPHRCAGRLEVWHGGRWGTVCDD
  GWDLRDAAVACRELGCGGALAAPGGARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVCTGP
  APRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFFGEGSGPIILDDLRCRG
  NETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPTDSNNSTPREAASRPPSTMTSQAPGTAGVSPPPA
  SPTVLWEPGPEAGSPQLRLVAGPSKCSGRLEVWHDQRWGTVCDDSWDMRDSAVVCRELGCGGPQQPDPAAGRFGW
  GAGPIWLDDVGCVGTEASLSDCPAAPWGKHNCAHNEDVGVTCTGPPGLDSISDPFSWSWIPGLGRDRDAWLPGEL
  ATKPSASVTASVLEKTTTKAPGKMPKSTKKWVTKNAKRPTTQPPVMPTTKHSRAQSPPDLTSQTTAALTTEASRR
  PTSEFTRRPTTEAPQRWTSHTTATLTPQAPRERTTKTMAMLTTQGPQEMTSESTIKSIPQASLEPSAEIPEGSPE
  SPKDPAPSPSVSTTGESGLFRVRLADGPNRCAGRLEVWHAGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKT
  HYGPGTGPIWLDDMGCKGSEASLSDCPSGAWGKHNCDHEEDVGLTCTGYTDYDDYPPWTWDPTSREDLAKGTTTA
  GVPGHTLPWRTTRRPGSSSPAIRRLPDTGSKDGYKLPWTWDTPSGRGLAEGTPTAGKLGPTLGAGTTRSPGSPPT
  LRVHGDTGSPRKPWPERRPPRPAATRTAPPTPSPGPSASPGPPGPALTSDSSRELTPHSALTSEATSDAPDTSPP
  TPDPASRTNPDLILTSPDFALSTPDSSVVPALTPEPSPTPLPTLPKELTSDPSTPSEVTSLSPTSEQVPESDTTP
  DLDTTPYSSTVSEYSRSPDPSPSPHPTTTPDPTMAPDPITTLNPTVTPHFPTTPHPTTTPHPTTITHSTMIPDPT
  TTPQPFTTITHSTMIPDPTTTPQPFTTMQPTTTPHSTTPHPTTTPHPTTITHSTMIPDPTTTPQPFTTMQPTTMP
  HPTTTPHPTTTPHPTTTPHPTTTPHPTMTPDPTTTPYPTTTPDPTTTPHPTTPDPSSTPVITTVSLPTSLGTELS
  SPTLAPTVKPSLHPQLTFTAPAPHTSTSQIPTLEPSPALESSPSRSSTATSMDPLSTEDFKPPRSQSPNLTPPPT
  HTPHSASDLTVSPDPLLSPTAHPLDHPPLDPLTLGPTPGQSPGPHGPCVAPTPPVRVMACEPPALVELVAAVRDV
  GGQLQRLTQVVEQERQERQALLLGLTQLVEAARGLGQLGEAVKRLAEMAWTTSMPAPTTTTPEEEERPLRGDV

• Structural information:
  • Protein Domains: (20..12-)
    (/note="SRCR-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (198..29-)
    (/note="SRCR-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (304..40-)
    (/note="SRCR-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (-)
  • Interpro: IPR001190  IPR017448  IPR036772  
  • Prosite: PS00420 PS50287
  • STRING: ENSP00000374274
• Other Databases: GeneCards:  SSC5D  Malacards:  SSC5D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000483	negative regulation of interleukin-8 secretion	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0043236	laminin binding	IEA	molecular function
GO:0042494	detection of bacterial lipoprotein	IEA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0001968	fibronectin binding	IEA	molecular function
GO:2000482	regulation of interleukin-8 secretion	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0006952	defense response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0042494	detection of bacterial lipoprotein	ISS	biological process
GO:0001968	fibronectin binding	ISS	molecular function
GO:2000483	negative regulation of interleukin-8 secretion	ISS	biological process
GO:0043236	laminin binding	ISS	molecular function
GO:0005044	scavenger receptor activity	ISS	molecular function
GO:0050840	extracellular matrix binding	ISS	molecular function
GO:0062023	collagen-containing extracellular matrix	ISS	cellular component
GO:0005615	extracellular space	ISS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray