• Gene id: 284273

Gene Summary

• Gene Symbol: ZADH2   Gene   UCSC   Ensembl
• Aliases: PRG-3
• Gene name: zinc binding alcohol dehydrogenase domain containing 2
• Alternate names: prostaglandin reductase 3, zinc-binding alcohol dehydrogenase domain-containing protein 2,
• Gene location: 18q22.3 (75209505: 75195107)     Exons: 3     NC_000018.10

Protein Summary

• Protein general information: Q8N4Q0  
  • Name: Prostaglandin reductase 3 (PRG 3) (EC 1.3.1.48) (Zinc binding alcohol dehydrogenase domain containing protein 2)
  • Length: 377  
  • Mass: 40140
• Sequence:

  MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVN
  ASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEY
  LTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYK
  TEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASV
  QGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPHSVNS
  KL

• Structural information:
  • Interpro: IPR013149  IPR013154  IPR011032  IPR036291  IPR020843   IPR002364  
  • Prosite: PS01162
  • PDB: 2C0C 2WEK 2X1H 2X7H
  • PDBsum: 2C0C 2WEK 2X1H 2X7H
  • STRING: ENSP00000323678
• Other Databases: GeneCards:  ZADH2  Malacards:  ZADH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IEA	molecular function
GO:0036132	13-prostaglandin reductase activity	IEA	molecular function
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0036132	13-prostaglandin reductase activity	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0005777	peroxisome	ISS	cellular component
GO:0036132	13-prostaglandin reductase activity	ISS	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R