• Gene id: 284257

Gene Summary

• Gene Symbol: BOD1L2   Gene   UCSC   Ensembl
• Aliases: BOD1P, FAM44C
• Gene name: biorientation of chromosomes in cell division 1 like 2
• Alternate names: biorientation of chromosomes in cell division protein 1-like 2, biorientation of chromosomes in cell division 1 pseudogene, biorientation of chromosomes in cell division protein 1 pseudogene, family with sequence similarity 44, member C, putative biorientatio,
• Gene location: 18q21.31 (57147086: 57150409)     Exons: 1     NC_000018.10

Protein Summary

• Protein general information: Q8IYS8  
  • Name: Biorientation of chromosomes in cell division protein 1 like 2 (Biorientation of chromosomes in cell division protein 1 pseudogene) (Protein FAM44C)
  • Length: 172  
  • Mass: 18075
• Sequence:

  MADGGGGGSGGAGPASTRASGGGGPINPASLPPGDPQLIAIIVGQLKSRGLFDSFRRDCKADVDTKPAYQNLSQK
  ADNFVSTHLDKQEWNPPANDNQLHDGLRQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEA
  AVPALPPEPEGQDPPAPSQDTS

• Structural information:
  • Interpro: IPR026955  
  • STRING: ENSP00000467843
• Other Databases: GeneCards:  BOD1L2  Malacards:  BOD1L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000922	spindle pole	IBA	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IBA	biological process
GO:0051721	protein phosphatase 2A binding	IBA	molecular function
GO:0000940	condensed chromosome outer kinetochore	IBA	cellular component
GO:0004864	protein phosphatase inhibitor activity	IBA	molecular function
GO:0005813	centrosome	IBA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)