• Gene id: 284207

Gene Summary

• Gene Symbol: METRNL   Gene   UCSC   Ensembl
• Gene name: meteorin like, glial cell differentiation regulator
• Alternate names: meteorin-like protein, cometin, meteorin, glial cell differentiation regulator-like, subfatin,
• Gene location: 17q25.3 (83079608: 83095125)     Exons: 7     NC_000017.11

Protein Summary

• Protein general information: Q641Q3  
  • Name: Meteorin like protein (Subfatin)
  • Length: 311  
  • Mass: 34398
  • Tissue specificity: Highly expressed in the skeletal muscle, in subcutaneous adipose tissue, epididymal white adipose tissue depots and heart. Also expressed in brown adipose tissues and kidney. {ECO
• Sequence:

  MRGAARAAWGRAGQPWPRPPAPGPPPPPLPLLLLLLAGLLGGAGAQYSSDRCSWKGSGLTHEAHRKEVEQVYLRC
  AAGAVEWMYPTGALIVNLRPNTFSPARHLTVCIRSFTDSSGANIYLEKTGELRLLVPDGDGRPGRVQCFGLEQGG
  LFVEATPQQDIGRRTTGFQYELVRRHRASDLHELSAPCRPCSDTEVLLAVCTSDFAVRGSIQQVTHEPERQDSAI
  HLRVSRLYRQKSRVFEPVPEGDGHWQGRVRTLLECGVRPGHGDFLFTGHMHFGEARLGCAPRFKDFQRMYRDAQE
  RGLNPCEVGTD

• Structural information:
  • Interpro: IPR039224  
  • STRING: ENSP00000315731
• Other Databases: GeneCards:  METRNL  Malacards:  METRNL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090336	positive regulation of brown fat cell differentiation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0097009	energy homeostasis	IBA	biological process
GO:0005179	hormone activity	IBA	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0090336	positive regulation of brown fat cell differentiation	ISS	biological process
GO:0050873	brown fat cell differentiation	ISS	biological process
GO:0014850	response to muscle activity	ISS	biological process
GO:0005179	hormone activity	ISS	molecular function
GO:0097009	energy homeostasis	ISS	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:0009409	response to cold	ISS	biological process
GO:0014850	response to muscle activity	IEA	biological process
GO:0090336	positive regulation of brown fat cell differentiation	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0090336	positive regulation of brown fat cell differentiation	IEA	biological process
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0014850	response to muscle activity	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0097009	energy homeostasis	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045444	fat cell differentiation	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq