• Gene id: 284194

Gene Summary

• Gene Symbol: LGALS9B   Gene   UCSC   Ensembl
• Gene name: galectin 9B
• Alternate names: galectin-9B, gal-9B, galectin-9 like, galectin-9 pseudogene, galectin-9-like protein A, lectin, galactoside-binding, soluble, 9B,
• Gene location: 17p11.2 (20467534: 20449394)     Exons: 11     NC_000017.11
• Gene summary(Entrez): This gene was initially thought to represent a pseudogene of galectin 9; however, this transcript has good exon-intron structure and encodes a predicted protein of the same size as and highly similar to galectin 9. This gene is one of two similar loci on
• OMIM: 616241

Protein Summary

• Protein general information: Q3B8N2  
  • Name: Galectin 9B (Gal 9B) (Galectin 9 like protein A)
  • Length: 356  
  • Mass: 39660
• Sequence:

  MAFSGSQAPYLSPAVPFSGTIQGGLQDGFQITVNGAVLSSSGTRFAVDFQTGFSGNDIAFHFNPRFEDGGYVVCN
  TRQKGRWGPEERKMHMPFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDTISVNGSVQLSYISFQNP
  RTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYP
  MPFITTIPGGLYPSKSIILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQINNSWGSEERSLPRKMP
  FVRGQSFSVWILCEAHCLKVAVDGQHVFEYYHRLRNLPTINKLEVGGDIQLTHVQT

• Structural information:
  • Protein Domains: (17..14-)
    (/note="Galectin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639-)
    (228..35-)
    (/note="Galectin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00639"-)
  • Interpro: IPR013320  IPR001079  
  • Prosite: PS51304
  • CDD: cd00070
  • STRING: ENSP00000315564
• Other Databases: GeneCards:  LGALS9B  Malacards:  LGALS9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010629	negative regulation of gene expression	IBA	biological process
GO:0016936	galactoside binding	IBA	molecular function
GO:0030246	carbohydrate binding	IBA	molecular function
GO:0032689	negative regulation of interferon-gamma production	IBA	biological process
GO:2000562	negative regulation of CD4-positive, alpha-beta T cell proliferation	IBA	biological process
GO:2000778	positive regulation of interleukin-6 secretion	IBA	biological process
GO:2001181	positive regulation of interleukin-10 secretion	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0010628	positive regulation of gene expression	IBA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq