• Gene id: 284161

Gene Summary

• Gene Symbol: GDPD1   Gene   UCSC   Ensembl
• Aliases: GDE4
• Gene name: glycerophosphodiester phosphodiesterase domain containing 1
• Alternate names: lysophospholipase D GDPD1, glycerophosphodiester phosphodiesterase 4, glycerophosphodiester phosphodiesterase domain-containing protein 1,
• Gene location: 17q22 (59220469: 59275969)     Exons: 12     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the glycerophosphodiester phosphodiesterase family of enzymes that catalyze the hydrolysis of deacylated glycerophospholipids to glycerol phosphate and alcohol. The encoded protein is localized to the cytoplasm and concentrat
• OMIM: 617353

Protein Summary

• Protein general information: Q8N9F7  
  • Name: Lysophospholipase D GDPD1 (EC 3.1.4.39) (Glycerophosphodiester phosphodiesterase 4) (Glycerophosphodiester phosphodiesterase domain containing protein 1)
  • Length: 314  
  • Mass: 36167
  • Tissue specificity: Widely expressed with high expression level in testis. {ECO
• Sequence:

  MSSTAAFYLLSTLGGYLVTSFLLLKYPTLLHQRKKQRFLSKHISHRGGAGENLENTMAAFQHAVKIGTDMLELDC
  HITKDEQVVVSHDENLKRATGVNVNISDLKYCELPPYLGKLDVSFQRACQCEGKDNRIPLLKEVFEAFPNTPINI
  DIKVNNNVLIKKVSELVKRYNREHLTVWGNANYEIVEKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPIREQ
  FFEIPMPSIILKLKEPHTMSRSQKFLIWLSDLLLMRKALFDHLTARGIQVYIWVLNEEQEYKRAFDLGATGVMTD
  YPTKLRDFLHNFSA

• Structural information:
  • Protein Domains: (40..30-)
    (/note="GP-PDE"-)
  • Interpro: IPR030395  IPR017946  
  • Prosite: PS51704
  • STRING: ENSP00000284116
• Other Databases: GeneCards:  GDPD1  Malacards:  GDPD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0004622	lysophospholipase activity	IBA	molecular function
GO:0070291	N-acylethanolamine metabolic process	IBA	biological process
GO:0046475	glycerophospholipid catabolic process	IBA	biological process
GO:0008081	phosphoric diester hydrolase activity	IBA	molecular function
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0005783	endoplasmic reticulum	IMP	cellular component
GO:0070291	N-acylethanolamine metabolic process	IMP	biological process
GO:0008081	phosphoric diester hydrolase activity	IMP	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0047391	alkylglycerophosphoethanolamine phosphodiesterase activity	IEA	molecular function
GO:0004622	lysophospholipase activity	IMP	molecular function
GO:0070291	N-acylethanolamine metabolic process	IMP	biological process
GO:0004622	lysophospholipase activity	IEA	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0070291	N-acylethanolamine metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00565	Ether lipid metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R