• Gene id: 284114

Gene Summary

• Gene Symbol: TMEM102   Gene   UCSC   Ensembl
• Aliases: CBAP
• Gene name: transmembrane protein 102
• Alternate names: transmembrane protein 102, common beta-chain associated protein,
• Gene location: 17p13.1 (7435434: 7437678)     Exons: 3     NC_000017.11
• OMIM: 614056

Protein Summary

• Protein general information: Q8N9M5  
  • Name: Transmembrane protein 102 (Common beta chain associated protein) (CBAP)
  • Length: 508  
  • Mass: 54175
• Sequence:

  MASAVWGSAPWWGPPPPAPARPLTDIDFCSGAQLQELTQLIQELGVQESWSDGPKPGADLLRAKDFVFSLLGLVH
  RRDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYARGPHYDAGFTLLVPMFSLDGTELQLDLESCYAQVCLPEMV
  CGTPIREMWQDCLGPPVPGARDSIHRTESEESSKDWQSSVDQPHSYVTEHEAPVSLEKSPSDVSASESPQHDVVD
  LGSTAPLKTMSSDVTKAAVESPVPKPSEAREAWPTLCSAQVAAWFFATLAAVAESLIPVPGAPRLVHAARHAGFT
  TVLLATPEPPRRLLLFDLIPVVSVAGWPEGARSHSWAGPLASESASFYLVPGGGTERPCASAWQLCFARQELALK
  ARIPAPLLQAHAAAQALLRPLVAGTRAAAPYLLRTLLYWACERLPALYLARPENAGACCLGLLDELGRVLEAGTL
  PHYFLNGRQLRTGDDSAALLGELARLRGDPARALRAAVEEAKVARKGGGLAGVGGGAH

• Structural information:
  • Interpro: IPR024810  IPR024806  
  • STRING: ENSP00000315387
• Other Databases: GeneCards:  TMEM102  Malacards:  TMEM102

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:2000406	positive regulation of T cell migration	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000406	positive regulation of T cell migration	IEA	biological process
GO:0050730	regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IEA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:1901028	regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	biological process
GO:0034097	response to cytokine	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881