• Gene id: 284106

Gene Summary

• Gene Symbol: CISD3   Gene   UCSC   Ensembl
• Aliases: MiNT, Miner2
• Gene name: CDGSH iron sulfur domain 3
• Alternate names: CDGSH iron-sulfur domain-containing protein 3, mitochondrial, mitoNEET related 2, mitoNEET-related protein 2, mitochondrial inner NEET protein,
• Gene location: 17q12 (38730340: 38735604)     Exons: 4     NC_000017.11
• Gene summary(Entrez): CISD3 is a member of the CDGSH domain-containing family, which may play a role in regulating electron transport and oxidative phosphorylation (Wiley et al., 2007 [PubMed 17376863]).[supplied by OMIM, Apr 2008]

Protein Summary

• Protein general information: P0C7P0  
  • Name: CDGSH iron sulfur domain containing protein 3, mitochondrial (MitoNEET related protein 2) (Miner2) (Mitochondrial inner NEET protein) (MiNT)
  • Length: 127  
  • Mass: 14216
• Sequence:

  MRGAGAILRPAARGARDLNPRRDISSWLAQWFPRTPARSVVALKTPIKVELVAGKTYRWCVCGRSKKQPFCDGSH
  FFQRTGLSPLKFKAQETRMVALCTCKATQRPPYCDGTHRSERVQKAEVGSPL

• Structural information:
  • Interpro: IPR018967  IPR042216  
  • PDB: 6AVJ
  • PDBsum: 6AVJ
  • STRING: ENSP00000483781
• Other Databases: GeneCards:  CISD3  Malacards:  CISD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0106034	protein maturation by [2Fe-2S] cluster transfer	IDA	biological process
GO:0046872	metal ion binding	IDA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq