• Gene id: 284098

Gene Summary

• Gene Symbol: PIGW   Gene   UCSC   Ensembl
• Aliases: Gwt1, HPMRS5
• Gene name: phosphatidylinositol glycan anchor biosynthesis class W
• Alternate names: phosphatidylinositol-glycan biosynthesis class W protein,
• Gene location: 17q12 (36534761: 36539302)     Exons: 2     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is an inositol acyltransferase that acylates the inositol ring of phosphatidylinositol. This occurs in the endoplasmic reticulum and is a step in the biosynthesis of glycosylphosphatidylinositol (GPI), which anchors many c
• OMIM: 100640

Protein Summary

• Protein general information: Q7Z7B1  
  • Name: Phosphatidylinositol glycan biosynthesis class W protein (PIG W) (EC 2.3. . )
  • Length: 504  
  • Mass: 56882
• Sequence:

  MSEKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSPTWKTRFLTDFVVLIVPMVATLTIW
  ASFILLELLGVIIFGAGLLYQIYRRRTCYARLPFLKILEKFLNISLESEYNPAISCFRVITSAFTAIAILAVDFP
  LFPRRFAKTELYGTGAMDFGVGGFVFGSAMVCLEVRRRKYMEGSKLHYFTNSLYSVWPLVFLGIGRLAIIKSIGY
  QEHLTEYGVHWNFFFTIIVVKLITPLLLIIFPLNKSWIIALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLN
  ANREGIISTLGYVAIHMAGVQTGLYMHKNRSHIKDLIKVACFLLLAAISLFISLYVVQVNVEAVSRRMANLAFCI
  WIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRKQLI
  FFLLSNITTGLINLMVDTLHSSTLWALFVVNLYMFSNCLIVYVLYLQDKTVQFW

• Structural information:
  • Interpro: IPR009447  
  • STRING: ENSP00000482202
• Other Databases: GeneCards:  PIGW  Malacards:  PIGW

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0006506	GPI anchor biosynthetic process	IBA	biological process
GO:0032216	glucosaminyl-phosphatidylinositol O-acyltransferase activity	IBA	molecular function
GO:0006505	GPI anchor metabolic process	IC	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0006506	GPI anchor biosynthetic process	IEA	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0006506	GPI anchor biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0008374	O-acyltransferase activity	TAS	molecular function
GO:0016254	preassembly of GPI anchor in ER membrane	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006506	GPI anchor biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00563	Glycosylphosphatidylinositol

Diseases

Associated diseases	References
Inherited glycosylphosphatidylinositol deficiencies	KEGG:H01489
Hyperphosphatasia with mental retardation syndrome	KEGG:H01488
Inherited glycosylphosphatidylinositol deficiencies	KEGG:H01489
Hyperphosphatasia with mental retardation syndrome	KEGG:H01488
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881