About Us

Search Result


Gene id 283987
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol HID1   Gene   UCSC   Ensembl
Aliases 17orf28, C17orf28, DMC1, HID-1
Gene name HID1 domain containing
Alternate names protein HID1, HID1 domain-containing protein, UPF0663 transmembrane protein C17orf28, down-regulated in multiple cancers 1, downregulated in multiple cancer 1, protein hid-1 homolog,
Gene location 17q25.1 (74972762: 74950741)     Exons: 19     NC_000017.11

Protein Summary

Protein general information Q8IV36  

Name: Protein HID1 (Down regulated in multiple cancers 1) (HID1 domain containing protein) (Protein hid 1 homolog)

Length: 788  Mass: 88745

Tissue specificity: Expressed in heart, skeletal muscle, colon, spleen, kidney, liver, small intestine and lung. Highest expression is seen in brain and placenta. Loss of expression is seen in some breast, cervical, hepatocellular, lung, thyroid, gastric

Sequence MGSTDSKLNFRKAVIQLTTKTQPVEATDDAFWDQFWADTATSVQDVFALVPAAEIRAVREESPSNLATLCYKAVE
KLVQGAESGCHSEKEKQIVLNCSRLLTRVLPYIFEDPDWRGFFWSTVPGAGRGGQGEEDDEHARPLAESLLLAIA
DLLFCPDFTVQSHRRSTVDSAEDVHSLDSCEYIWEAGVGFAHSPQPNYIHDMNRMELLKLLLTCFSEAMYLPPAP
ESGSTNPWVQFFCSTENRHALPLFTSLLNTVCAYDPVGYGIPYNHLLFSDYREPLVEEAAQVLIVTLDHDSASSA
SPTVDGTTTGTAMDDADPPGPENLFVNYLSRIHREEDFQFILKGIARLLSNPLLQTYLPNSTKKIQFHQELLVLF
WKLCDFNKKFLFFVLKSSDVLDILVPILFFLNDARADQSRVGLMHIGVFILLLLSGERNFGVRLNKPYSIRVPMD
IPVFTGTHADLLIVVFHKIITSGHQRLQPLFDCLLTIVVNVSPYLKSLSMVTANKLLHLLEAFSTTWFLFSAAQN
HHLVFFLLEVFNNIIQYQFDGNSNLVYAIIRKRSIFHQLANLPTDPPTIHKALQRRRRTPEPLSRTGSQEGTSME
GSRPAAPAEPGTLKTSLVATPGIDKLTEKSQVSEDGTLRSLEPEPQQSLEDGSPAKGEPSQAWREQRRPSTSSAS
GQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQAN
SGTAMWFRTYMWGVIYLRNVDPPVWYDTDVKLFEIQRV
Structural information
Interpro:  IPR026705  
STRING:   ENSP00000413520
Other Databases GeneCards:  HID1  Malacards:  HID1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000138 Golgi trans cisterna
IBA cellular component
GO:0005797 Golgi medial cisterna
IBA cellular component
GO:0016020 membrane
IBA cellular component
GO:0090498 extrinsic component of Go
lgi membrane
IDA cellular component
GO:0005881 cytoplasmic microtubule
IDA cellular component
GO:0005797 Golgi medial cisterna
IDA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0000138 Golgi trans cisterna
IDA cellular component
GO:0005794 Golgi apparatus
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0000139 Golgi membrane
IEA cellular component
GO:0005794 Golgi apparatus
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0070062 extracellular exosome
HDA cellular component
Associated diseases References
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract