• Gene id: 283871

Gene Summary

• Gene Symbol: PGP   Gene   UCSC   Ensembl
• Aliases: AUM, G3PP, PGPase
• Gene name: phosphoglycolate phosphatase
• Alternate names: glycerol-3-phosphate phosphatase, aspartate-based ubiquitous Mg(2+)-dependent phosphatase,
• Gene location: 16p13.3 (2214839: 2211592)     Exons: 2     NC_000016.10
• OMIM: 172280

Protein Summary

• Protein general information: A6NDG6  
  • Name: Glycerol 3 phosphate phosphatase (G3PP) (EC 3.1.3.21) (Aspartate based ubiquitous Mg(2+) dependent phosphatase) (AUM) (EC 3.1.3.48) (Phosphoglycolate phosphatase) (PGP)
  • Length: 321  
  • Mass: 34006
  • Tissue specificity: Detected in all tissues including red cells, lymphocytes and cultured fibroblasts (at protein level). The highest activities occur in skeletal muscle and cardiac muscle. {ECO
• Sequence:

  MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNSSKTRA
  AYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVASVGVGPEPLQG
  EGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMA
  AQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSK
  KKMVPDFYVDSIADLLPALQG

• Structural information:
  • Interpro: IPR036412  IPR006357  IPR023214  IPR006349  
  • STRING: ENSP00000330918
• Other Databases: GeneCards:  PGP  Malacards:  PGP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016311	dephosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006114	glycerol biosynthetic process	IBA	biological process
GO:0006650	glycerophospholipid metabolic process	IBA	biological process
GO:0016791	phosphatase activity	IBA	molecular function
GO:0043136	glycerol-3-phosphatase activity	IBA	molecular function
GO:0043136	glycerol-3-phosphatase activity	IDA	molecular function
GO:0008967	phosphoglycolate phosphatase activity	IDA	molecular function
GO:0006650	glycerophospholipid metabolic process	IDA	biological process
GO:0006114	glycerol biosynthetic process	IDA	biological process
GO:0016311	dephosphorylation	ISS	biological process
GO:0004725	protein tyrosine phosphatase activity	ISS	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0098519	nucleotide phosphatase activity, acting on free nucleotides	ISS	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	ISS	biological process
GO:0045721	negative regulation of gluconeogenesis	IMP	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000121	glycerol-1-phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0098519	nucleotide phosphatase activity, acting on free nucleotides	IEA	molecular function
GO:0043136	glycerol-3-phosphatase activity	IEA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006650	glycerophospholipid metabolic process	IEA	biological process
GO:0006114	glycerol biosynthetic process	IEA	biological process
GO:0045721	negative regulation of gluconeogenesis	IEA	biological process
GO:0043136	glycerol-3-phosphatase activity	IEA	molecular function
GO:0006650	glycerophospholipid metabolic process	IEA	biological process
GO:0006114	glycerol biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa00630	Glyoxylate and dicarboxylate metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)