• Gene id: 283807

Gene Summary

• Gene Symbol: FBXL22   Gene   UCSC   Ensembl
• Aliases: Fbl22
• Gene name: F-box and leucine rich repeat protein 22
• Alternate names: F-box and leucine-rich protein 22, F-box/LRR-repeat protein 22,
• Gene location: 15q22.31 (63597386: 63603431)     Exons: 2     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family. This F-box protein interacts with S-phase kinase-associated protein 1A and cullin in order to form SCF complexes which function as ubiquitin ligases.[provided by RefSeq, Sep 2010]
• OMIM: 609088

Protein Summary

• Protein general information: Q6P050  
  • Name: F box and leucine rich protein 22
  • Length: 247  
  • Mass: 27269
  • Tissue specificity: Enriched in cardiac muscle. {ECO
• Sequence:

  MWPLLTMHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLS
  ICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLSAVRSPRRREAPAPSSGTPIAVGPKSPRWGG
  PDHSEFADLRSGVTGARAAARRGLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAP
  PCGFARTRVCPPTFPGADAFPQ

• Structural information:
  • Protein Domains: (6..5-)
    (/note="F-box"-)
  • Interpro: IPR036047  IPR001810  
  • STRING: ENSP00000353794
• Other Databases: GeneCards:  FBXL22  Malacards:  FBXL22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0030018	Z disc	IBA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030018	Z disc	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)