• Gene id: 283742

Gene Summary

• Gene Symbol: FAM98B   Gene   UCSC   Ensembl
• Gene name: family with sequence similarity 98 member B
• Alternate names: protein FAM98B,
• Gene location: 15q14 (38454126: 38487709)     Exons: 1     NC_000015.10
• OMIM: 616142

Protein Summary

• Protein general information: Q52LJ0  
  • Name: Protein FAM98B
  • Length: 433  
  • Mass: 45547
  • Tissue specificity: Expressed strongly in colorectal cancer tissues compared to wild-type colon samples (at protein level) (PubMed
• Sequence:

  MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRD
  DLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQLDKNSEVYQEV
  QAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRML
  MKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAINKV
  LMGRVPDRGGRPNEIEPPPPEMPPWQKRQEGGGGRGGWGGGGGGGGRGGGGGGGGRGGWGGGGGGWGGGGGGGGG
  WGGGGGGGRGGFQGRGDYGGRGGYGGRGGYGGRGYGDPYGGGGGGGGGGGGGGGYRRY

• Structural information:
  • Interpro: IPR018797  
  • DIP: 50585
  • STRING: ENSP00000380734
• Other Databases: GeneCards:  FAM98B  Malacards:  FAM98B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072669	tRNA-splicing ligase complex	IBA	cellular component
GO:0072669	tRNA-splicing ligase complex	IDA	cellular component
GO:0072669	tRNA-splicing ligase complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0006479	protein methylation	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0008276	protein methyltransferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881