• Gene id: 283643

Gene Summary

• Gene Symbol: TEDC1   Gene   UCSC   Ensembl
• Aliases: C14orf80
• Gene name: tubulin epsilon and delta complex 1
• Alternate names: tubulin epsilon and delta complex protein 1, uncharacterized protein C14orf80,
• Gene location: 14q32.33 (105489854: 105499247)     Exons: 12     NC_000014.9
• OMIM: 612945

Protein Summary

• Protein general information: Q86SX3  
  • Name: Tubulin epsilon and delta complex protein 1
  • Length: 495  
  • Mass: 54231
• Sequence:

  MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEATSALWQLLFRVLSPLPAGNALASLAL
  EVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLARGPVPEQMLAQARVPLGDEMTVCQCEALASP
  GPPAPHMEAEGPVDVRHVQWLMGKLRFRWRQLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEG
  GQQVSGAGAAQNLDLAYPKCLHSFCTPGMGPRTFWNDLWLVCEQPGLLPGDWAAPLDPGGASACSLLSPFRALLR
  TLERENQRLEAVLAWRRSELVFWRWMDTVLGTCAPEVPAAASQPTFLPWVPERGGGELDLVVRELQALEEELREA
  AERRRAAWEAKAGGCGRGPEWSAARRASREAVEKELGALQQCWERDGGPAQPHGPHRLVRREDGAAGDRDLRAAV
  VIRTLRSQEACLEAVLRRLQGQCRQELARLVGARPGLIWIPPPGR

• Structural information:
  • Interpro: IPR027996  IPR028100  
  • DIP: 62062
  • STRING: ENSP00000376307
• Other Databases: GeneCards:  TEDC1  Malacards:  TEDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005814	centriole	ISS	cellular component
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005814	centriole	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005814	centriole	ISS	cellular component
GO:0045880	positive regulation of smoothened signaling pathway	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005814	centriole	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005814	centriole	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881