Search Result
Gene id | 283635 | ||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
Gene Symbol | FAM177A1 Gene UCSC Ensembl | ||||||||||||||||||||||||
Aliases | C14orf24 | ||||||||||||||||||||||||
Gene name | family with sequence similarity 177 member A1 | ||||||||||||||||||||||||
Alternate names | protein FAM177A1, | ||||||||||||||||||||||||
Gene location |
14q13.2 (149129623: 149173731) Exons: 18 NC_000003.12 |
||||||||||||||||||||||||
Gene summary(Entrez) |
This gene encodes a member of a conserved protein family. Alternative splicing results in multiple transcript variants. This gene is thought to be associated with susceptibility to juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017] |
||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
Protein general information | Q8N128 Name: Protein FAM177A1 Length: 213 Mass: 23757 | ||||||||||||||||||||||||
Sequence |
MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDE VDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYRMKKEEEEEE EENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVPP | ||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||
Other Databases | GeneCards: FAM177A1  Malacards: FAM177A1 | ||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
|