• Gene id: 283629

Gene Summary

• Gene Symbol: TSSK4   Gene   UCSC   Ensembl
• Aliases: C14orf20, STK22E, TSK-4, TSK4, TSSK5
• Gene name: testis specific serine kinase 4
• Alternate names: testis-specific serine/threonine-protein kinase 4, serine/threonine kinase 22E, serine/threonine-protein kinase 22E,
• Gene location: 14q12 (24205523: 24208361)     Exons: 4     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the testis-specific serine/threonine kinase family. The encoded protein is thought to be involved in spermatogenesis via stimulation of the CREB/CRE responsive pathway through phosphorylation of the cAMP responsive element bi
• OMIM: 610711

Protein Summary

• Protein general information: Q6SA08  
  • Name: Testis specific serine/threonine protein kinase 4 (TSK 4) (TSSK 4) (Testis specific kinase 4) (EC 2.7.11.1) (Serine/threonine protein kinase 22E)
  • Length: 328  
  • Mass: 37,454
  • Tissue specificity: Ubiquitous. Higher expression levels observed in the temporal lobe and fetal brain. {ECO
• Sequence:

  MGKGDVLEAAPTTTAYHSLMDEYGYEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKKASDDYLNKFLPREIQ
  VMKVLRHKYLINFYRAIESTSRVYIILELAQGGDVLEWIQRYGACSEPLAGKWFSQLTLGIAYLHSKSIVHRDLK
  LENLLLDKWENVKISDFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLPYNPFLSDTWSM
  GVILYTLVVAHLPFDDTNLKKLLRETQKEVTFPANHTISQECKNLILQMLRQATKRATILDIIKDSWVLKFQPEQ
  PTHEIRLLEAMCQLHNTTKQHQSLQITT

• Structural information:
  • Protein Domains: Protein (25-293)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000339179
• Other Databases: GeneCards:  TSSK4  Malacards:  TSSK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IDA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IDA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	ISS	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IDA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process

Diseases

Associated diseases	References
Chronic renal failure	GAD: 21085059
Azoospermia	GAD: 20378615
Male factor infertility	MIK: 18390560
Spermatogenesis defects	MIK: 18390560
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201
Required for maintatining the structural integrity of sperm flagellum and male infertility	MIK: 25361759
Spermatogenic impairment	MIK: 18390560

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18390560	Spermatogenic impairment	c.679G>A, c.987+108G>A, c.-155C>G and c.765C>A	Chinese	592 (372 patients with azoospermia or severe oligospermia, 220 controls)	Male infertility
25361759	Required for maintatining the structural integrity of sperm flagellum and male infertility				Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray