• Gene id: 283576

Gene Summary

• Gene Symbol: ZDHHC22   Gene   UCSC   Ensembl
• Aliases: C14orf59
• Gene name: zinc finger DHHC-type palmitoyltransferase 22
• Alternate names: palmitoyltransferase ZDHHC22, DHHC-22, putative palmitoyltransferase ZDHHC22, zinc finger DHHC domain-containing protein 22, zinc finger DHHC-type containing 22, zinc finger, DHHC domain containing 22,
• Gene location: 14q24.3 (77146264: 77131269)     Exons: 5     NC_000014.9

Protein Summary

• Protein general information: Q8N966  
  • Name: Palmitoyltransferase ZDHHC22 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 22) (DHHC 22) (zDHHC22)
  • Length: 263  
  • Mass: 29100
• Sequence:

  MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLFLSANALGNYVLVIQNSPDD
  LGACQGASARKTPCPSPSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFVLFCLYTSLACLYSMVAGVAYISA
  VLSISFAHPLAFLTLLPTSISQFFSGAVLGSEMFVILMLYLWFAIGLACAGFCCHQLLLILRGQTRHQVRKGVAV
  RARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK

• Structural information:
  • Protein Domains: (81..13-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  IPR000731  
  • Prosite: PS50216 PS50156
  • STRING: ENSP00000318222
• Other Databases: GeneCards:  ZDHHC22  Malacards:  ZDHHC22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0018345	protein palmitoylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0018345	protein palmitoylation	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq