• Gene id: 283459

Gene Summary

• Gene Symbol: GATC   Gene   UCSC   Ensembl
• Aliases: 15E1.2, COXPD42
• Gene name: glutamyl-tRNA amidotransferase subunit C
• Alternate names: glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial, glu-AdT subunit C, glutamyl-tRNA(Gln) amidotransferase, subunit C homolog,
• Gene location: 12q24.31 (120446443: 120463748)     Exons: 5     NC_000012.12

Protein Summary

• Protein general information: O43716  
  • Name: Glutamyl tRNA(Gln) amidotransferase subunit C, mitochondrial (Glu AdT subunit C) (EC 6.3.5. ) (Protein 15E1.2)
  • Length: 136  
  • Mass: 15086
• Sequence:

  MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGV
  EPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS

• Structural information:
  • Interpro: IPR003837  IPR036113  
  • DIP: 48969
  • STRING: ENSP00000446872
• Other Databases: GeneCards:  GATC  Malacards:  GATC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IBA	biological process
GO:0032543	mitochondrial translation	IBA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IBA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IDA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IDA	molecular function
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0032543	mitochondrial translation	IMP	biological process
GO:0006450	regulation of translational fidelity	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0032543	mitochondrial translation	IEA	biological process
GO:0050567	glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity	IEA	molecular function
GO:0016884	carbon-nitrogen ligase activity, with glutamine as amido-N-donor	IEA	molecular function
GO:0070681	glutaminyl-tRNAGln biosynthesis via transamidation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0030956	glutamyl-tRNA(Gln) amidotransferase complex	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq