• Gene id: 283431

Gene Summary

• Gene Symbol: GAS2L3   Gene   UCSC   Ensembl
• Aliases: G2L3
• Gene name: growth arrest specific 2 like 3
• Alternate names: GAS2-like protein 3, growth arrest-specific protein 2-like 3,
• Gene location: 12q23.1 (100573667: 100628287)     Exons: 14     NC_000012.12
• OMIM: 617224

Protein Summary

• Protein general information: Q86XJ1  
  • Name: GAS2 like protein 3 (Growth arrest specific protein 2 like 3)
  • Length: 694  
  • Mass: 75214
  • Tissue specificity: Expressed in the pancreas, heart, liver, placenta, brain, skeletal muscle, kidney and lung. {ECO
• Sequence:

  MQPAIQVWFGEDLPLSPRSPLTPRHGPGLANVCQYDEWIAVRHEATLLPMQEDLSIWLSGLLGIKVKAEKLLEEL
  DNGVLLCQLIDVLQNMVKTCNSEESGNFPMRKVPCKKDAASGSFFARDNTANFLHWCRDIGVDETYLFESEGLVL
  HKDPRQVYLCLLEIGRIVSRYGVEPPVLVKLEKEIELEETLLNTSGPEDSISIPKSCCRHEELHEAVKHIAEDPP
  CSCSHRFSIEYLSEGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQKGVS
  NESVPDSPARTPQPPEMNPLSAVNMFQKQNSKPSVPVSIPKSKEKQGRPPGALVPASSLKGGNLGSMSVRSKLPN
  SPAASSHPKLKSSKGITKKPQAPSNNASSSLASLNPVGKNTSSPALPRTAPCISESPRKCISSPNTPKAKVIPAQ
  NSADLPESTLLPNKCSGKTQPKYLKHNHISSRDNAVSHLAAHSNSSSKCPKLPKANIPVRPKPSFQSSAKMTKTS
  SKTIATGLGTQSQPSDGAPQAKPVPAQKLKSALNLNQPVSVSSVSPVKATQKSKDKNIVSATKKQPQNKSAFQKT
  GPSSLKSPGRTPLSIVSLPQSSTKTQTAPKSAQTVAKSQHSTKGPPRSGKTPASIRKPPSSVKDADSGDKKPTAK
  KKEDDDHYFVMTGSKKPRK

• Structural information:
  • Protein Domains: (48..16-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (208..28-)
    (/note="GAR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00792"-)
  • Interpro: IPR001715  IPR036872  IPR003108  IPR036534  IPR029932  
  • Prosite: PS50021 PS51460
  • CDD: cd00014
  • STRING: ENSP00000448955
• Other Databases: GeneCards:  GAS2L3  Malacards:  GAS2L3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0005874	microtubule	IBA	cellular component
GO:0005884	actin filament	IBA	cellular component
GO:0008093	cytoskeletal anchor activity	IBA	molecular function
GO:0051764	actin crosslink formation	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0051015	actin filament binding	IBA	molecular function
GO:0030036	actin cytoskeleton organization	IDA	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0000226	microtubule cytoskeleton organization	IDA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881