• Gene id: 283375

Gene Summary

• Gene Symbol: SLC39A5   Gene   UCSC   Ensembl
• Aliases: LZT-Hs7, MYP24, ZIP5
• Gene name: solute carrier family 39 member 5
• Alternate names: zinc transporter ZIP5, solute carrier family 39 (metal ion transporter), member 5, solute carrier family 39 (zinc transporter), member 5, zrt- and Irt-like protein 5,
• Gene location: 12q13.3 (56230035: 56237849)     Exons: 13     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the ZIP family of zinc transporters that transport zinc into cells from outside, and play a crucial role in controlling intracellular zinc levels. Zinc is an essential cofactor for many enzymes and proteins invo
• OMIM: 608730

Protein Summary

• Protein general information: Q6ZMH5  
  • Name: Zinc transporter ZIP5 (Solute carrier family 39 member 5) (Zrt and Irt like protein 5) (ZIP 5)
  • Length: 540  
  • Mass: 56461
  • Tissue specificity: Expressed in liver, kidney, pancreas, small intestine, colon, spleen, fetal liver and fetal kidney. {ECO
• Sequence:

  MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRL
  GQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSL
  ADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSL
  PSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFV
  LENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSH
  GHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSL
  VSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLA
  ITLLEERLLPVTTEG

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000266980
• Other Databases: GeneCards:  SLC39A5  Malacards:  SLC39A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0071578	zinc ion import across plasma membrane	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030509	BMP signaling pathway	IBA	biological process
GO:0030509	BMP signaling pathway	IMP	biological process
GO:0001654	eye development	IMP	biological process
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0034224	cellular response to zinc ion starvation	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0061351	neural precursor cell proliferation	ISS	biological process
GO:0070315	G1 to G0 transition involved in cell differentiation	ISS	biological process

Diseases

Associated diseases	References
Myopia	KEGG:H02041
Myopia	KEGG:H02041
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)