• Gene id: 2833

Gene Summary

• Gene Symbol: CXCR3   Gene   UCSC   Ensembl
• Aliases: CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR
• Gene name: C-X-C motif chemokine receptor 3
• Alternate names: C-X-C chemokine receptor type 3, G protein-coupled receptor 9, IP-10 receptor, Mig receptor, chemokine (C-X-C motif) receptor 3, chemokine receptor 3, interferon-inducible protein 10 receptor,
• Gene location: Xq13.1 (71618514: 71615912)     Exons: 4     NC_000023.11
• Gene summary(Entrez): This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant)
• OMIM: 605542

SNPs

rs7354779

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000021.9   g.44250887T>C
NC_000021.8   g.45670770T>C
NM_013369.3   c.832A>G
NM_013369.4   c.832A>G
NM_175867.2   c.832A>G
NM_175867.3   c.832A>G
NR_135514.1   n.75T>C
NP_037501.2   p.Arg278Gly
NP_787063.1   p.Arg278Gly|SEQ=[T/C]|GENE=DNMT3L
DNMT3L-AS1   1053728

Protein Summary

• Protein general information: P49682  
  • Name: C X C chemokine receptor type 3 (CXC R3) (CXCR 3) (CKR L2) (G protein coupled receptor 9) (Interferon inducible protein 10 receptor) (IP 10 receptor) (CD antigen CD183)
  • Length: 368  
  • Mass: 40660
  • Tissue specificity: Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level). {ECO
• Sequence:

  MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLGNGAVA
  AVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRY
  LNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFL
  LPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
  SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL

• Structural information:
  • Interpro: IPR004070  IPR000355  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • DIP: 5891
  • STRING: ENSP00000362795
• Other Databases: GeneCards:  CXCR3  Malacards:  CXCR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0002685	regulation of leukocyte migration	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0019722	calcium-mediated signaling	IEA	biological process
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0010818	T cell chemotaxis	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0019956	chemokine binding	IPI	molecular function
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0006935	chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0002685	regulation of leukocyte migration	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0019722	calcium-mediated signaling	IEA	biological process
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular function
GO:0010818	T cell chemotaxis	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0019956	chemokine binding	IPI	molecular function
GO:0007166	cell surface receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
pulmonary sarcoidosis	PMID:9834133
Thoracic aortic aneurysm	PMID:16014397
Cystic fibrosis	PMID:19017998
Asthma	PMID:17641057
Asthma	PMID:16043121
Chronic obstructive pulmonary disease	PMID:19218194
systemic scleroderma	PMID:21303517
Coronary restenosis	PMID:14578618
Myasthenia gravis	PMID:15843529
Rheumatoid arthritis	PMID:19017998
Pulmonary emphysema	PMID:15526056
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881